Protein Info for BWI76_RS19970 in Klebsiella michiganensis M5al

Annotation: anaerobic glycerol-3-phosphate dehydrogenase subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03378: glycerol-3-phosphate dehydrogenase, anaerobic, B subunit
  • amino acids 3 to 409 (407 residues), 507.8 bits, E=1.2e-156
• PF00890: FAD_binding_2
  • amino acids 4 to 399 (396 residues), 227.5 bits, E=3.7e-71

Best Hits

Swiss-Prot: 79% identical to GLPB_KLEP7: Anaerobic glycerol-3-phosphate dehydrogenase subunit B (glpB) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K00112, glycerol-3-phosphate dehydrogenase subunit B [EC: 1.1.5.3] (inferred from 79% identity to kpn:KPN_02648)

MetaCyc: 64% identical to anaerobic glycerol-3-phosphate dehydrogenase subunit B (Escherichia coli K-12 substr. MG1655)
Glycerol-3-phosphate dehydrogenase. [EC: 1.1.5.3]

Predicted SEED Role

"Anaerobic glycerol-3-phosphate dehydrogenase subunit B (EC 1.1.5.3)" in subsystem Glycerol and Glycerol-3-phosphate Uptake and Utilization or Glycerolipid and Glycerophospholipid Metabolism in Bacteria or Respiratory dehydrogenases 1 (EC 1.1.5.3)

MetaCyc Pathways

• glycerol and glycerophosphodiester degradation (4/4 steps found)
• glycerol degradation I (3/3 steps found)
• glycerol-3-phosphate shuttle (2/2 steps found)
• glycerol-3-phosphate to fumarate electron transfer (2/2 steps found)
• glycerophosphodiester degradation (2/2 steps found)
• nitrate reduction IX (dissimilatory) (2/2 steps found)
• glycerol 3-phosphate to cytochrome aa₃ oxidase electron transfer (1/2 steps found)
• glycerol-3-phosphate to cytochrome bo oxidase electron transfer (1/2 steps found)
• glycerol-3-phosphate to hydrogen peroxide electron transport (1/2 steps found)
• sn-glycerol 3-phosphate anaerobic respiration (1/3 steps found)

KEGG Metabolic Maps

• Glycerophospholipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.5.3

Use Curated BLAST to search for 1.1.5.3

Sequence Analysis Tools

See A0A285B748 at UniProt or InterPro

Protein Sequence (419 amino acids)

>BWI76_RS19970 anaerobic glycerol-3-phosphate dehydrogenase subunit B (Klebsiella michiganensis M5al)
MKFDCAIIGGGLAGLLCGLALNQRGLRSVIISRGQSALHFSSASLDLLSTLPNGETVTDV
AHGIGQLARQLSEHPYARLGAERVMGYASQAQALFADCGIAMQGEASQPHLRVTPLGTLR
AAWLSPQEIATAPLPANGVCVVGISGFGDFQPHLAAASLNQHGVHAEAQEIDLPLLDVLR
DSPSEFRAANIARRLDDETQWPALLAALRPLAQRHRFIIMPACFGLADDRLYQWLQQRLP
CPLRLLPTLPPSVPGMRLHAQLQRHFIRGGGTWLTGDEVINISQQNGIVNAIWTRNHGDI
PLRPRFAVLASGSFFSNGLVAERSGVREPILGLDLQQTLPRERWYQQDFFASQPWQRFGL
KTDAALRPQLQGQTLENLFAVGSILGGFDAIALGCGGGVCAVTALHAARLIGELAGGES