Protein Info for BWI76_RS19945 in Klebsiella michiganensis M5al

Annotation: ribonucleotide-diphosphate reductase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 376 transmembrane" amino acids 195 to 218 (24 residues), see Phobius details PF00268: Ribonuc_red_sm" amino acids 32 to 332 (301 residues), 176.9 bits, see alignment E=3e-56

Best Hits

Swiss-Prot: 97% identical to RIR2_SALTY: Ribonucleoside-diphosphate reductase 1 subunit beta (nrdB) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00526, ribonucleoside-diphosphate reductase beta chain [EC: 1.17.4.1] (inferred from 96% identity to eco:b2235)

MetaCyc: 96% identical to ribonucleoside-diphosphate reductase 1 subunit beta (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Ribonucleotide reductase of class Ia (aerobic), beta subunit (EC 1.17.4.1)" in subsystem Ribonucleotide reduction (EC 1.17.4.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.17.4.1

Use Curated BLAST to search for 1.17.4.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6R6 at UniProt or InterPro

Protein Sequence (376 amino acids)

>BWI76_RS19945 ribonucleotide-diphosphate reductase subunit beta (Klebsiella michiganensis M5al)
MAYTTFSQTKNDQLLEPMFFGQPVNVARYDQQKYDIFEKLIEKQLSFFWRPEEVDVSRDR
IDYQALPEHEKHIFISNLKYQTLLDSIQGRSPNVALLPLISIPELETWVETWAFSETIHS
RSYTHIIRNIVNDPAMVFDDIVTNEQIQKRAEGISSYYDELIELTSYWHLLGEGTHSVNG
KTITVNLRELKKKLYLCLMSVNALEAIRFYVSFACSFAFAERKLMEGNAKIIRLIARDEA
LHLTGTQHMLNLLRSGVDDPEMASIAEECKQACYDLFVQAAQQEKEWADYLFRDGSMIGL
NKDILCQYVEYITNIRMQAVGLDLPFQTRSNPIPWINTWLVSDNVQVAPQEVEVSSYLVG
QIDSEVDADDLSNFQL