Protein Info for BWI76_RS19940 in Klebsiella michiganensis M5al

Annotation: ribonucleoside-diphosphate reductase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03477: ATP-cone
  • amino acids 6 to 92 (87 residues), 49.2 bits, E=9.8e-17
• PF00317: Ribonuc_red_lgN
  • amino acids 142 to 219 (78 residues), 55.7 bits, E=6.3e-19
• TIGR02506: ribonucleoside-diphosphate reductase, alpha subunit
  • amino acids 145 to 735 (591 residues), 590.4 bits, E=2.2e-181
• PF02867: Ribonuc_red_lgC
  • amino acids 223 to 732 (510 residues), 469.5 bits, E=2.1e-144

Best Hits

Swiss-Prot: 95% identical to RIR1_SALTY: Ribonucleoside-diphosphate reductase 1 subunit alpha (nrdA) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)

KEGG orthology group: K00525, ribonucleoside-diphosphate reductase alpha chain [EC: 1.17.4.1] (inferred from 96% identity to esc:Entcl_1485)

MetaCyc: 95% identical to ribonucleoside-diphosphate reductase 1 subunit alpha (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"Ribonucleotide reductase of class Ia (aerobic), alpha subunit (EC 1.17.4.1)" in subsystem Ribonucleotide reduction (EC 1.17.4.1)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (46/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (26/26 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (18/18 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (14/14 steps found)
• superpathway of purine nucleotide salvage (13/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis I (9/9 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (8/8 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis II (7/7 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis III (8/9 steps found)
• superpathway of adenosine nucleotides de novo biosynthesis I (5/5 steps found)
• adenosine deoxyribonucleotides de novo biosynthesis II (4/4 steps found)
• guanosine deoxyribonucleotides de novo biosynthesis II (4/4 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis IV (6/7 steps found)
• adenosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
• guanosine deoxyribonucleotides de novo biosynthesis I (2/2 steps found)
• pyrimidine deoxyribonucleotides biosynthesis from CTP (6/8 steps found)

KEGG Metabolic Maps

• Glutathione metabolism
• Purine metabolism
• Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.17.4.1

Use Curated BLAST to search for 1.17.4.1

Sequence Analysis Tools

See A0A285B6Z0 at UniProt or InterPro

Protein Sequence (761 amino acids)

>BWI76_RS19940 ribonucleoside-diphosphate reductase subunit alpha (Klebsiella michiganensis M5al)
MNQSLLVTKRDGSTERINLDKIHRVLDWAAEGLNNVSISQVELRSHIQFYDGIKTADIHE
TIIKAAADLISRDAPDYQYLAARLAIFHLRKKAYGQFEPPALFDHVSKMVKNGKYDTHLL
EDYTEEEFKQMDSFIEHDRDMTFSYAAVKQLEGKYLVQNRVTGEIYESAQFLYILVAACL
FSNYPRETRLDYIKRFYDAVSTFKISLPTPIMSGVRTPTRQFSSCVLIECGDSLDSINAT
SSAIVKYVSQRAGIGINAGRIRALGSPIRGGEAFHTGCIPFYKHFQTAVKSCSQGGVRGG
AATLFYPMWHLEVESLLVLKNNRGTDANRVRHMDYGVQINKLMYTRLLKGGDITLFSPSD
VPGLYDAFFADQDEFERLYTKYEQDDSIRKQRIKAVELFSLMMQERASTGRIYIQNVDHC
NTHSPFDPVVAPVRQSNLCLEIALPTKPLEDVNDENGEIALCTLSAFNLGVIDSLDELEE
LAVLAVRALDALLDYQDYPIPAAKRGAMGRRTLGIGVINFAYYLAKHGKRYSDGSANNLT
HKTFEAIQYYLLKASNELAIEQGACPWFNETTYAKGILPIDTYKKDLDAIVNESLHYDWE
ALRESIKTHGLRNSTLSALMPSETSSQISNATNGIEPPRGHVSIKASKDGILRQVVPDYE
KLQNGYELLWEMPNNDGYLQLVGIMQKFIDQSISANTNYDPTRFPSGKVPMQQLLKDLLN
AYKFGVKTLYYHNTRDGAEDAQDDLAPSIQDDGCESGACKI