Protein Info for BWI76_RS19930 in Klebsiella michiganensis M5al

Annotation: bifunctional 3-demethylubiquinone 3-O-methyltransferase/2-octaprenyl-6-hydroxy phenol methylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 242 TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase" amino acids 16 to 234 (219 residues), 297.3 bits, see alignment E=2.9e-93 PF01209: Ubie_methyltran" amino acids 47 to 160 (114 residues), 41.8 bits, see alignment E=4.7e-14 PF05175: MTS" amino acids 56 to 128 (73 residues), 28.8 bits, see alignment E=4.6e-10 PF02353: CMAS" amino acids 57 to 187 (131 residues), 36.5 bits, see alignment E=2e-12 PF06325: PrmA" amino acids 57 to 161 (105 residues), 28.3 bits, see alignment E=6.9e-10 PF13489: Methyltransf_23" amino acids 57 to 167 (111 residues), 86 bits, see alignment E=1.4e-27 PF07021: MetW" amino acids 57 to 150 (94 residues), 23.1 bits, see alignment E=2.8e-08 PF13847: Methyltransf_31" amino acids 57 to 165 (109 residues), 64.2 bits, see alignment E=6.7e-21 PF05401: NodS" amino acids 58 to 181 (124 residues), 25.7 bits, see alignment E=5.2e-09 PF13649: Methyltransf_25" amino acids 60 to 153 (94 residues), 72.4 bits, see alignment E=2.3e-23 PF08242: Methyltransf_12" amino acids 61 to 154 (94 residues), 58.3 bits, see alignment E=5.9e-19 PF08241: Methyltransf_11" amino acids 61 to 157 (97 residues), 79.7 bits, see alignment E=1.1e-25

Best Hits

Swiss-Prot: 93% identical to UBIG_SALDC: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Salmonella dublin (strain CT_02021853)

KEGG orthology group: None (inferred from 97% identity to eae:EAE_24235)

MetaCyc: 90% identical to bifunctional 3-demethylubiquinone-8 3-O-methyltransferase and 2-octaprenyl-6-hydroxyphenol methylase (Escherichia coli K-12 substr. MG1655)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; 2-OCTAPRENYL-6-OHPHENOL-METHY-RXN [EC: 2.1.1.64, 2.1.1.222]

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.64

Use Curated BLAST to search for 2.1.1.222 or 2.1.1.64

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6T8 at UniProt or InterPro

Protein Sequence (242 amino acids)

>BWI76_RS19930 bifunctional 3-demethylubiquinone 3-O-methyltransferase/2-octaprenyl-6-hydroxy phenol methylase (Klebsiella michiganensis M5al)
MNAEKPSVAHNVDHNEIAKFEAVASRWWDLEGEFKPLHRINPLRLGYIAERSGGLFGKKV
LDVGCGGGILAESMAREGATVTGLDMGFEPLQVARLHALESGIQVEYVQETVEEHAAKHA
QQYDVVTCMEMLEHVPDPQSVVHACARLVKPGGQVFFSTINRNGKAWLMAVVGAEYVMKM
VPKGTHDAKKFIKPAELIGWVDETILKEQHITGLHYNPLTNTFKLAPGVDVNYMLHTTAK
KA