Protein Info for BWI76_RS19930 in Klebsiella michiganensis M5al

Annotation: bifunctional 3-demethylubiquinone 3-O-methyltransferase/2-octaprenyl-6-hydroxy phenol methylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase
  • amino acids 16 to 234 (219 residues), 297.3 bits, E=2.9e-93
• PF01209: Ubie_methyltran
  • amino acids 47 to 160 (114 residues), 41.8 bits, E=4.7e-14
• PF13847: Methyltransf_31
  • amino acids 57 to 170 (114 residues), 68.9 bits, E=2.3e-22
• PF05175: MTS
  • amino acids 57 to 127 (71 residues), 27.3 bits, E=1.4e-09
• PF06325: PrmA
  • amino acids 57 to 161 (105 residues), 29 bits, E=4.3e-10
• PF07021: MetW
  • amino acids 57 to 150 (94 residues), 23.4 bits, E=2.3e-08
• PF02353: CMAS
  • amino acids 57 to 187 (131 residues), 36.5 bits, E=2e-12
• PF13489: Methyltransf_23
  • amino acids 57 to 170 (114 residues), 86.7 bits, E=7.9e-28
• PF05401: NodS
  • amino acids 58 to 181 (124 residues), 25.7 bits, E=5.2e-09
• PF13649: Methyltransf_25
  • amino acids 60 to 153 (94 residues), 72.1 bits, E=2.7e-23
• PF08241: Methyltransf_11
  • amino acids 61 to 157 (97 residues), 79.7 bits, E=1.1e-25
• PF08242: Methyltransf_12
  • amino acids 61 to 154 (94 residues), 58.2 bits, E=6.4e-19

Best Hits

Swiss-Prot: 93% identical to UBIG_SALDC: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Salmonella dublin (strain CT_02021853)

KEGG orthology group: None (inferred from 97% identity to eae:EAE_24235)

MetaCyc: 90% identical to bifunctional 3-demethylubiquinone-8 3-O-methyltransferase and 2-octaprenyl-6-hydroxyphenol methylase (Escherichia coli K-12 substr. MG1655)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; 2-OCTAPRENYL-6-OHPHENOL-METHY-RXN [EC: 2.1.1.64, 2.1.1.222]

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

• superpathway of chorismate metabolism (54/59 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (12/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (8/8 steps found)
• ubiquinol-8 biosynthesis (late decarboxylation) (6/9 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (2/9 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (3/11 steps found)

KEGG Metabolic Maps

• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.64

Use Curated BLAST to search for 2.1.1.222 or 2.1.1.64

Sequence Analysis Tools

See A0A285B6T8 at UniProt or InterPro

Protein Sequence (242 amino acids)

>BWI76_RS19930 bifunctional 3-demethylubiquinone 3-O-methyltransferase/2-octaprenyl-6-hydroxy phenol methylase (Klebsiella michiganensis M5al)
MNAEKPSVAHNVDHNEIAKFEAVASRWWDLEGEFKPLHRINPLRLGYIAERSGGLFGKKV
LDVGCGGGILAESMAREGATVTGLDMGFEPLQVARLHALESGIQVEYVQETVEEHAAKHA
QQYDVVTCMEMLEHVPDPQSVVHACARLVKPGGQVFFSTINRNGKAWLMAVVGAEYVMKM
VPKGTHDAKKFIKPAELIGWVDETILKEQHITGLHYNPLTNTFKLAPGVDVNYMLHTTAK
KA