Protein Info for BWI76_RS19900 in Klebsiella michiganensis M5al

Annotation: FAD:protein FMN transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF02424: ApbE" amino acids 41 to 324 (284 residues), 274.4 bits, see alignment E=5.4e-86

Best Hits

Swiss-Prot: 90% identical to APBE1_KLEP3: FAD:protein FMN transferase (apbE1) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K03734, thiamine biosynthesis lipoprotein (inferred from 90% identity to kpe:KPK_1517)

MetaCyc: 77% identical to FAD:protein FMN transferase (Escherichia coli K-12 substr. MG1655)
RXN-14461 [EC: 2.7.1.180]

Predicted SEED Role

"Thiamin biosynthesis lipoprotein ApbE"

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B7C5 at UniProt or InterPro

Protein Sequence (350 amino acids)

>BWI76_RS19900 FAD:protein FMN transferase (Klebsiella michiganensis M5al)
MDITFFRAALFGACVLLSGCDSATAPQTPKSAATVLEGKTMGTFWRLSVINLDEAKGEAL
RQKVQAQLDADDRLLSTWKNDSALMRFNHSPGTSPWPVNEAMADIVTMSLRIGAKTHGAM
DITVGPLVNLWGFGPDKQPVKTPDPQQIAAAKARSGLQHLTVINQAGQQYLQKDIPDLFV
DLSTVGEGYAADHLARLMEQEGISRYLVSVGGALVSRGMNAEGQPWRVAIQKPTDRENAV
QAIVDINGHGISTSGSYRNYYELDGKRISHVIDPQTGRPIDHKLVSVTVIAPTALEADGW
DTGLMVLGPEKAQDVVREQELAVYMIVKEGDGFKTWMSPQFRAFLVGEKN