Protein Info for BWI76_RS19875 in Klebsiella michiganensis M5al

Annotation: sulfate transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 415 transmembrane" amino acids 31 to 52 (22 residues), see Phobius details amino acids 59 to 90 (32 residues), see Phobius details amino acids 100 to 120 (21 residues), see Phobius details amino acids 131 to 150 (20 residues), see Phobius details amino acids 158 to 177 (20 residues), see Phobius details amino acids 184 to 202 (19 residues), see Phobius details amino acids 229 to 249 (21 residues), see Phobius details amino acids 270 to 294 (25 residues), see Phobius details amino acids 306 to 322 (17 residues), see Phobius details amino acids 330 to 349 (20 residues), see Phobius details amino acids 367 to 394 (28 residues), see Phobius details PF00916: Sulfate_transp" amino acids 29 to 152 (124 residues), 60.4 bits, see alignment E=1.4e-20 amino acids 157 to 344 (188 residues), 85.7 bits, see alignment E=3e-28

Best Hits

KEGG orthology group: None (inferred from 87% identity to kva:Kvar_1423)

Predicted SEED Role

"Sulfate permease" in subsystem Cysteine Biosynthesis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B722 at UniProt or InterPro

Protein Sequence (415 amino acids)

>BWI76_RS19875 sulfate transporter (Klebsiella michiganensis M5al)
MPPVSDSATSGNAGALGQILRSPALLTRETLAGVLTALALIPEVISFSVIAGVDPKVSLI
ASVVLCLAMSLLGGRPAMVTAAAGSVALVIGPMVHQYGVGYILPAVVLAGVIQILFGVCG
MARLMRFIPQAVMTGFVNALGILIFFAQVPHFWSKQPLIIGLFVLTLLIVLWAPRFIKAI
PSPLIAIVLLTLFTVFSGQLLPTVGDEGSMSGGLPGFTSLMVPLDLTTLSIIWPCALSIA
FVGLMESLLTAKLVDDLTHTPSSKARESAGLGIANILAGFYGGIAGCAMIGQTIVNVEMG
KARSRVSTIVAGLVLLLLVTALSEVMAKIPMAVLAGVMVIVAVKTFSWHSVRPAELARNP
WPETLVMLVTVGATVSTSNLAIGVLAGLVSMALIPRRLRNQARATSEKSSPAQEK