Protein Info for BWI76_RS19855 in Klebsiella michiganensis M5al

Annotation: AI-2E family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 transmembrane" amino acids 5 to 23 (19 residues), see Phobius details amino acids 29 to 46 (18 residues), see Phobius details amino acids 59 to 85 (27 residues), see Phobius details amino acids 152 to 176 (25 residues), see Phobius details amino acids 212 to 233 (22 residues), see Phobius details amino acids 239 to 267 (29 residues), see Phobius details amino acids 275 to 295 (21 residues), see Phobius details amino acids 318 to 342 (25 residues), see Phobius details PF01594: AI-2E_transport" amino acids 13 to 340 (328 residues), 170.6 bits, see alignment E=2.9e-54

Best Hits

KEGG orthology group: None (inferred from 91% identity to eae:EAE_24160)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6Q5 at UniProt or InterPro

Protein Sequence (368 amino acids)

>BWI76_RS19855 AI-2E family transporter (Klebsiella michiganensis M5al)
MRVNGLTKGFFILIVLIVTLAFFDVLSPYYSAILWAAILAVIFHPVKNKLRDRIGERNGL
AAFLTIVIICLIVFTPLAIILSSLAFELNVVYTKLQHNDTQFPTVVASLFAHLPEWARSF
LSEHDLDSAEQIQRQLSDVALKGGQYLAGSAFLIGKGTFGFTISFGIMLYLLFFLLKDGP
YLVRLILESLPLSNHVKQHLFAKFAAVARATVKGTVAVALAQGALGGLAFWIVGLDGSIL
WGALMAFLSLIPAVGSAIIWVPAAVYLFATGQLWQGAFIVGFFVIIVGLVDNILRPLLVG
KDTKMPDYLILITTIGGMEIYGINGFVIGPLIAALFIACWNLLSGRDHAGNIDELDEDFL
EEGKNHEE