Protein Info for BWI76_RS19825 in Klebsiella michiganensis M5al

Annotation: DNA mismatch repair protein MutT

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00052: nudix-type nucleoside diphosphatase, YffH/AdpP family
  • amino acids 12 to 189 (178 residues), 150.8 bits, E=1.6e-48
• PF00293: NUDIX
  • amino acids 48 to 167 (120 residues), 27.4 bits, E=1.5e-10

Best Hits

Swiss-Prot: 56% identical to NUDK_SERP5: GDP-mannose pyrophosphatase NudK (nudK) from Serratia proteamaculans (strain 568)

KEGG orthology group: None (inferred from 92% identity to eae:EAE_24135)

MetaCyc: 55% identical to GDP-mannose hydrolase (Escherichia coli K-12 substr. MG1655)
3.6.1.-

Predicted SEED Role

"Nudix hydrolase family protein YffH" in subsystem Nudix proteins (nucleoside triphosphate hydrolases)

Sequence Analysis Tools

See A0A285B6R5 at UniProt or InterPro

Protein Sequence (197 amino acids)

>BWI76_RS19825 DNA mismatch repair protein MutT (Klebsiella michiganensis M5al)
MHADAPRVRHIRETLLSDNWYTLKKYTFELLRRDGRWQEQSREAYDRGNGAVILLYNREK
QTVVLVRQFRFPVWINGHDGFLIEAAAGLLDNASPEARIVAEAEEETGFRVTRIEPVFTA
YMSPGSVTEKLYFFIAEYSADDRRGDGGGLATEGEDIEVLEWPLEKALRAIGEGEIVDAK
TIMLLQHLALNAATLLA