Protein Info for BWI76_RS19820 in Klebsiella michiganensis M5al

Annotation: 50S ribosomal protein L25

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 94 PF01386: Ribosomal_L25p" amino acids 4 to 91 (88 residues), 89.3 bits, see alignment E=9.2e-30

Best Hits

Swiss-Prot: 90% identical to RL25_KLEP3: 50S ribosomal protein L25 (rplY) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K02897, large subunit ribosomal protein L25 (inferred from 92% identity to kpu:KP1_3849)

MetaCyc: 86% identical to 50S ribosomal subunit protein L25 (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"LSU ribosomal protein L25p" in subsystem Ribosome LSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B713 at UniProt or InterPro

Protein Sequence (94 amino acids)

>BWI76_RS19820 50S ribosomal protein L25 (Klebsiella michiganensis M5al)
MFTINAELRKEQGKGASRRLRAANKFPAIIYGGEAAPVAIELDHDKVWNMQNNAEFYNEV
LTLVVDGKEEKVKAQAVQRHPFKPKLTHIDFVRA