Protein Info for BWI76_RS19790 in Klebsiella michiganensis M5al

Annotation: putative binding-protein-dependent transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 341 transmembrane" amino acids 21 to 42 (22 residues), see Phobius details amino acids 143 to 167 (25 residues), see Phobius details amino acids 179 to 198 (20 residues), see Phobius details amino acids 204 to 224 (21 residues), see Phobius details amino acids 258 to 285 (28 residues), see Phobius details amino acids 306 to 328 (23 residues), see Phobius details PF12911: OppC_N" amino acids 12 to 45 (34 residues), 24.5 bits, see alignment 2e-09 PF00528: BPD_transp_1" amino acids 158 to 338 (181 residues), 104 bits, see alignment E=8.2e-34

Best Hits

Swiss-Prot: 88% identical to YEJE_ECOLI: Inner membrane ABC transporter permease protein YejE (yejE) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 92% identity to eae:EAE_24090)

MetaCyc: 88% identical to putative oligopeptide ABC transporter membrane subunit YejE (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppC (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6V8 at UniProt or InterPro

Protein Sequence (341 amino acids)

>BWI76_RS19790 putative binding-protein-dependent transporter (Klebsiella michiganensis M5al)
MSFFSPVNQARWARFRHNRRGYWSLWIFLALFACSLCAELIANDKPLLVQYRGSLYVPLL
KNYSETTFGGSFATAADYQDPWLQKRLDDNGWALWAPVRFGATTINFATDAPFPSPPSAQ
NWLGTDANGGDVLARILYGTRISILFGLLLTFFSSVLGVMAGAVQGYYGGKIDLWGQRFI
EVWSGMPTLFLIILLSSVVQANFWWLLAITVLFGWMTLVGVVRAEFLRTRNYDYIRAAQA
LGVSDRAIILRHMLPNAMVATLTFLPFILCSSITTLTSLDFLGFGLPLGSPSLGELLLQG
KNNLQAPWLGIAAFLSVAVLLTLLIFIGEAVRDAFDPSKAV