Protein Info for BWI76_RS19740 in Klebsiella michiganensis M5al

Annotation: sugar efflux transporter SetB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 393 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 52 to 72 (21 residues), see Phobius details amino acids 84 to 101 (18 residues), see Phobius details amino acids 107 to 129 (23 residues), see Phobius details amino acids 141 to 167 (27 residues), see Phobius details amino acids 170 to 194 (25 residues), see Phobius details amino acids 218 to 241 (24 residues), see Phobius details amino acids 255 to 276 (22 residues), see Phobius details amino acids 283 to 302 (20 residues), see Phobius details amino acids 308 to 330 (23 residues), see Phobius details amino acids 350 to 367 (18 residues), see Phobius details amino acids 372 to 390 (19 residues), see Phobius details TIGR00899: sugar efflux transporter" amino acids 19 to 392 (374 residues), 619.9 bits, see alignment E=8.3e-191 PF07690: MFS_1" amino acids 21 to 304 (284 residues), 129.5 bits, see alignment E=7.3e-42 amino acids 221 to 388 (168 residues), 66.1 bits, see alignment E=1.4e-22

Best Hits

Swiss-Prot: 85% identical to SETB_ECOLI: Sugar efflux transporter B (setB) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to eae:EAE_24035)

MetaCyc: 85% identical to sugar exporter SetB (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-82

Predicted SEED Role

"Sugar efflux transporter B"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6U1 at UniProt or InterPro

Protein Sequence (393 amino acids)

>BWI76_RS19740 sugar efflux transporter SetB (Klebsiella michiganensis M5al)
MQNSSAALPRRGFDLTSSAFLIVAFLTGIAGALQTPTLSLFLTNEVHVRPAMVGFFFTGS
AVIGILVSQFLAGRSDRKGDRKRLIVFCCLMGVLACVLFAWNRNYFILLFVGVFLSSFGS
TANPQMFALAREHADKTGREAVMFSSILRAQVSLAWVIGPPLAYALAMGFGFTVMYLSAA
VAFVVCGAMVWFFLPSMRKEPKIATGHLEAPRTNRRDALLLFIICTLMWGINSLYIINMP
LFIINELHLSEKLAGVMMGTAAGLEIPTMLIAGYYAKRFGKRFLMRISAVAGVLFYVGML
TVHTPGLLLALQALNAIFIGILAGIGMLYFQDLMPGQAGAATTLYTNTTRVGWIIAGSLA
GVVAEIWSYHAVFWIALVMGIATQACLWRIKDV