Protein Info for BWI76_RS19725 in Klebsiella michiganensis M5al

Annotation: PTS fructose transporter subunit EIIBC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 558 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 234 to 255 (22 residues), see Phobius details amino acids 267 to 292 (26 residues), see Phobius details amino acids 302 to 328 (27 residues), see Phobius details amino acids 348 to 368 (21 residues), see Phobius details amino acids 380 to 402 (23 residues), see Phobius details amino acids 414 to 450 (37 residues), see Phobius details amino acids 462 to 481 (20 residues), see Phobius details amino acids 488 to 508 (21 residues), see Phobius details amino acids 518 to 549 (32 residues), see Phobius details TIGR00829: PTS system, Fru family, IIB component" amino acids 107 to 190 (84 residues), 128.4 bits, see alignment E=9.8e-42 PF02302: PTS_IIB" amino acids 107 to 196 (90 residues), 73 bits, see alignment E=2.7e-24 TIGR01427: PTS system, Fru family, IIC component" amino acids 214 to 551 (338 residues), 489.2 bits, see alignment E=8e-151 PF02378: PTS_EIIC" amino acids 232 to 495 (264 residues), 64.7 bits, see alignment E=8e-22

Best Hits

Swiss-Prot: 89% identical to PTFBC_ECOLI: PTS system fructose-specific EIIB'BC component (fruA) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 94% identity to eae:EAE_24015)

MetaCyc: 89% identical to fructose-specific PTS multiphosphoryl transfer protein FruA (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"PTS system, fructose-specific IIB component (EC 2.7.1.69) / PTS system, fructose-specific IIC component (EC 2.7.1.69)" in subsystem Fructose utilization (EC 2.7.1.69)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.1.69

Use Curated BLAST to search for 2.7.1.69

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6N9 at UniProt or InterPro

Protein Sequence (558 amino acids)

>BWI76_RS19725 PTS fructose transporter subunit EIIBC (Klebsiella michiganensis M5al)
MKTLLIIDAGLGQARAYMAKTLLSTAAQKAQLELIDNPNDAELAIVLGTALPADSALNGK
KVYLGDINRAVAHPELFLGEAKSHATPYAAPTAAALPTAANGPKRIVAVTACPTGVAHTF
MAAEAIETEAKKRGWWVKVETRGSVGAGNAITPEEVEQADLVVVAADIEVDLAKFAGKPM
YRTTTGLALKKTAQELDKAVVEAKPYQPAGKSQAAAEGKKESAGAYRHLLTGVSYMLPMV
VAGGLCIALSFAFGIKAFEVKDTLAAALMQIGGGSAFALMVPVLAGFIAFSIADRPGLTP
GLIGGMLAVSTGSGFIGGIIAGFLAGYVAKAISTKLKLPQSMEALKPILIIPLVSSLIVG
LAMIYLIGKPVAGILEGLTHWLQTMGTANAVLLGAILGGMMCTDMGGPVNKAAYAFGVGL
LSTQTYAPMAAIMAAGMVPPLALGLATLIARKKFDKAQQEGGKAALVLGLCFITEGAIPF
AARDPMRVLPCCIVGGAVTGAMSMWVGAKLMAPHGGLFVLLIPGAITPVLGYLMAIVVGT
LVAGLSYAVLKRPEVQAA