Protein Info for BWI76_RS19705 in Klebsiella michiganensis M5al

Annotation: kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 362 PF13412: HTH_24" amino acids 1 to 48 (48 residues), 38.5 bits, see alignment 1e-13 PF08279: HTH_11" amino acids 4 to 53 (50 residues), 26.9 bits, see alignment 5.5e-10 PF00294: PfkB" amino acids 58 to 348 (291 residues), 195.4 bits, see alignment E=2.2e-61

Best Hits

Swiss-Prot: 70% identical to YEII_ECOLI: Uncharacterized sugar kinase YeiI (yeiI) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 83% identity to esc:Entcl_1541)

Predicted SEED Role

"Uncharacterized sugar kinase YeiI"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6W2 at UniProt or InterPro

Protein Sequence (362 amino acids)

>BWI76_RS19705 kinase (Klebsiella michiganensis M5al)
MNDREKQILKILRRNPLIQQHEIADILQISRSRVAAHIMDLTRKGAIKGKGYILTEQEYC
VSLGAVNMDIRGIADIHYPQPVSNPGNIQCSAGGVARNIAHNLALLGRDVHLISAVGSDF
YGETLLEQTRQAGVNVQSCIRLHGHNTATYLSIANPQEETVLAINDTHILQSLTPQLLNQ
YRDLLTHAGVVLVDCNLTEQSLEWVFTLTNAIPVFVDTVSEFKAHRIRPWLGKIHTLKPT
LRELQILWGEPIENEADRDRALAWLHERGTQRVVIYLEDDTIFCSEAGGERFRMSLPGHT
TIDSFGADDALMAGLLYSYLDGSDFKESAAFAMACTAITRASHSINNPSLSVDNALNLLA
NG