Protein Info for BWI76_RS19695 in Klebsiella michiganensis M5al

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 349 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 39 to 59 (21 residues), see Phobius details amino acids 80 to 98 (19 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 163 to 187 (25 residues), see Phobius details amino acids 199 to 214 (16 residues), see Phobius details amino acids 225 to 245 (21 residues), see Phobius details amino acids 264 to 284 (21 residues), see Phobius details amino acids 290 to 312 (23 residues), see Phobius details amino acids 323 to 345 (23 residues), see Phobius details TIGR00698: conserved hypothetical protein" amino acids 14 to 347 (334 residues), 517.1 bits, see alignment E=1e-159 PF03601: Cons_hypoth698" amino acids 18 to 326 (309 residues), 384.7 bits, see alignment E=1.3e-119

Best Hits

Swiss-Prot: 86% identical to YEIH_SALTI: UPF0324 inner membrane protein YeiH (yeiH) from Salmonella typhi

KEGG orthology group: None (inferred from 95% identity to kpe:KPK_1570)

Predicted SEED Role

"Putative membrane protein YeiH" in subsystem YeiH

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B765 at UniProt or InterPro

Protein Sequence (349 amino acids)

>BWI76_RS19695 membrane protein (Klebsiella michiganensis M5al)
MTALTLPTKHRPLRHFAPGLALTAVLTGAALWAGSFPAIAGAGFSALTLAILFGMVIGNT
VYPKIWQPCDGGVIFAKQHLLRLGIILYGFRLTFAQIADVGVGGIVIDVLTLSSTFFIAC
FLGQKVFGLDKHTSWLIGAGSSICGAAAVLATEPVVKAEASKVTVAVATVVIFGTIAIFL
YPAIYPFLAHWFTPEAYGIYMGSTMHEVAQVVAAGHAVGPDAENAAVIAKMLRVMMLAPF
LLFLAARVKQLSPANGGEKSKITIPWFAILFILVAVFNSFHLLPKAVVEMLVTLDTVLLA
MAMAALGLTTHVSALKKAGAKPLLMALMLFVWLIVGGGAINLAIHSLMA