Protein Info for BWI76_RS19655 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 385 transmembrane" amino acids 9 to 29 (21 residues), see Phobius details amino acids 48 to 76 (29 residues), see Phobius details amino acids 84 to 101 (18 residues), see Phobius details amino acids 107 to 122 (16 residues), see Phobius details amino acids 131 to 153 (23 residues), see Phobius details amino acids 198 to 216 (19 residues), see Phobius details amino acids 235 to 255 (21 residues), see Phobius details amino acids 276 to 292 (17 residues), see Phobius details amino acids 297 to 328 (32 residues), see Phobius details amino acids 335 to 356 (22 residues), see Phobius details PF04235: DUF418" amino acids 215 to 374 (160 residues), 147.3 bits, see alignment E=2e-47

Best Hits

Swiss-Prot: 77% identical to YEIB_ECOLI: Uncharacterized protein YeiB (yeiB) from Escherichia coli (strain K12)

KEGG orthology group: K07148, uncharacterized protein (inferred from 90% identity to kpn:KPN_02590)

Predicted SEED Role

"FIG00924762: possible membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6X5 at UniProt or InterPro

Protein Sequence (385 amino acids)

>BWI76_RS19655 hypothetical protein (Klebsiella michiganensis M5al)
MERNVTLDFVRGVAILGILLLNISAFGLPKAAYLNPAWSGNISASDAWTWAILDLLAQVK
FLTLFALLFGAGLQLLLPRGKRWIQSRLTLLALLGFVHGLFFWDGDILLAYALVGLVGWR
MVRDAHDVKSLFNTGVVLYIIGVAVLLLLGLISGNAPNRSWLPDAANLQYEQYWKLKGGF
EAVSNCADMLSDNLLALGAQYGWQLAGMMLMGAALMRSGWLKGQFSLRHYRRTGGLLIAA
GMAVNLPSIVAQWHLGWDYRWCAFLLQAPRELSAPLQTIGYAALAWGFWPQLCKFRLVGA
IACVGRMALTNYLLQTLICTTLFYRFGLFMKYDRLQLLAFVPPVWAVNLLFSWFWLRHFR
QGPVEWLWRQLTLRASGTSLKDTSR