Protein Info for BWI76_RS19615 in Klebsiella michiganensis M5al

Annotation: vancomycin high temperature exclusion protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 238 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF02698: DUF218" amino acids 47 to 170 (124 residues), 66.2 bits, see alignment E=1.4e-22

Best Hits

Swiss-Prot: 92% identical to SANA_ECOL6: Protein SanA (sanA) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03748, SanA protein (inferred from 92% identity to cko:CKO_00645)

Predicted SEED Role

"SanA protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6W1 at UniProt or InterPro

Protein Sequence (238 amino acids)

>BWI76_RS19615 vancomycin high temperature exclusion protein (Klebsiella michiganensis M5al)
MLKRVLYSLLVLFGLLLLTVLGLDRWMSWKTSPYIYDELQDLPYRQVGVVLGTAKYYRTG
VINQYYRYRIQGALNAYNSGKVNYLLLSGDNALQSYNEPMTMRRDLIKAGVDPADIVLDY
AGFRTLDSIVRTRKVFDTNDFIIITQRFHCERALFIALHMGIQAQCYAVPSPKDMWSVRL
REFGARFGALADLYIFKREPRFLGPLIPIPAQQEVPDGAQSYPAVTPQQLLELQKKEK