Protein Info for BWI76_RS19600 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 132 transmembrane" amino acids 10 to 28 (19 residues), see Phobius details amino acids 34 to 55 (22 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details PF03788: LrgA" amino acids 23 to 113 (91 residues), 104.4 bits, see alignment E=1.3e-34

Best Hits

Swiss-Prot: 91% identical to Y2539_KLEP7: UPF0299 membrane protein KPN78578_25390 (KPN78578_25390) from Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578)

KEGG orthology group: K06518, holin-like protein (inferred from 91% identity to kpu:KP1_3809)

Predicted SEED Role

"Antiholin-like protein LrgA" in subsystem Murein hydrolase regulation and cell death

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6U3 at UniProt or InterPro

Protein Sequence (132 amino acids)

>BWI76_RS19600 hypothetical protein (Klebsiella michiganensis M5al)
MSKSLIIVWQYLRAFVLIYACLYAGIFLSSLLPIAIPGSIIGMLILFFLLALQIMPPQWV
NPGCNILIRYMALLFVPIGVGVMQYWDLLRAQFGPVVVSCAISTLVVFLVVSWSSHLVHG
ERKVVGQKGSEE