Protein Info for BWI76_RS19545 in Klebsiella michiganensis M5al

Annotation: type 11 methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 244 PF13489: Methyltransf_23" amino acids 35 to 205 (171 residues), 60.2 bits, see alignment E=6.4e-20 PF01209: Ubie_methyltran" amino acids 37 to 140 (104 residues), 27.9 bits, see alignment E=4.6e-10 PF13847: Methyltransf_31" amino acids 42 to 148 (107 residues), 47.4 bits, see alignment E=5.5e-16 PF13649: Methyltransf_25" amino acids 46 to 137 (92 residues), 72.8 bits, see alignment E=9.1e-24 PF08242: Methyltransf_12" amino acids 47 to 139 (93 residues), 50 bits, see alignment E=1.3e-16 PF08241: Methyltransf_11" amino acids 47 to 141 (95 residues), 81.1 bits, see alignment E=2.2e-26

Best Hits

KEGG orthology group: None (inferred from 85% identity to eae:EAE_23850)

Predicted SEED Role

"Methyltransferase type 11"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6I6 at UniProt or InterPro

Protein Sequence (244 amino acids)

>BWI76_RS19545 type 11 methyltransferase (Klebsiella michiganensis M5al)
MSQNIYDDPAFFAGYATLDRSVKGLEGAPEWPTLQQMLPPLSGLRVVDLGCGYGWFCRWA
RDQGAAQVDGLDLSSRMLERAREMTEGEGIRYRCEDLQTLTLPADSCELVYSSLALHYLP
DVAPLFATVYRALTPGGTLLFSAEHPIYTAPPQQGWQVDENGQKSWPVSHYQQEGERISN
WFADGVKKQHRKLSSWINLLVAAGFIIEHLDEWGPTAEQIAAQPALDEEKERPMIFLLRA
RKPA