Protein Info for BWI76_RS19535 in Klebsiella michiganensis M5al

Annotation: putative integral membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 189 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 41 to 63 (23 residues), see Phobius details amino acids 93 to 115 (23 residues), see Phobius details amino acids 123 to 144 (22 residues), see Phobius details amino acids 162 to 180 (19 residues), see Phobius details PF09335: VTT_dom" amino acids 24 to 143 (120 residues), 69 bits, see alignment E=2.8e-23

Best Hits

Swiss-Prot: 76% identical to YOHD_ECOLI: Inner membrane protein YohD (yohD) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 87% identity to kpe:KPK_1594)

Predicted SEED Role

"DedA family inner membrane protein YohD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6Q4 at UniProt or InterPro

Protein Sequence (189 amino acids)

>BWI76_RS19535 putative integral membrane protein (Klebsiella michiganensis M5al)
MDINNLISQYGYAALVIGSMAEGETITLLGGVAAHQGLLKFWLVVISVALGGMIGDQLLY
LLGRRFGGRILRRFARQKKRIQKAQRMIQRRPYLFVIGTRFMYGFRVIGPLLIGASRLPP
KVFLPLNIVGAIIWALIFTTLGYLGGEAIGPWLHHLDAHLKHWIWLILAVALVVAAHWWL
KHREAKKKE