Protein Info for BWI76_RS19530 in Klebsiella michiganensis M5al

Annotation: YIP1 family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 195 transmembrane" amino acids 33 to 53 (21 residues), see Phobius details amino acids 66 to 91 (26 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 133 to 156 (24 residues), see Phobius details amino acids 169 to 190 (22 residues), see Phobius details PF04893: Yip1" amino acids 5 to 178 (174 residues), 123.5 bits, see alignment E=4.5e-40

Best Hits

Swiss-Prot: 88% identical to YOHC_ECOL6: Inner membrane protein YohC (yohC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: None (inferred from 95% identity to eae:EAE_23835)

Predicted SEED Role

"Putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6J2 at UniProt or InterPro

Protein Sequence (195 amino acids)

>BWI76_RS19530 YIP1 family protein (Klebsiella michiganensis M5al)
MNHVWGLFSHPNQEMSVIKSENETVSHHYTHHVLVMAAVPVICAFIGTTQLGWNFGDGTV
VKLSLMTGLALAVLFYAVMLAGVAVMGRVIWWMARSYPQRPSLKRCMVFAGYVATPLFLS
GLVALYPLVWLCALVGTVALLYTGYLLYLGIPTFLGINKEEGLSFASSTLAIGVLVLEVL
LAITVILWGYGYRLF