Protein Info for BWI76_RS19525 in Klebsiella michiganensis M5al

Annotation: D-alanyl-D-alanine endopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 315 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00768: Peptidase_S11" amino acids 30 to 261 (232 residues), 275.6 bits, see alignment E=3.4e-86 PF13354: Beta-lactamase2" amino acids 44 to 183 (140 residues), 35 bits, see alignment E=9.5e-13

Best Hits

Swiss-Prot: 84% identical to PBP7_ECOLI: D-alanyl-D-alanine endopeptidase (pbpG) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 95% identity to eae:EAE_23830)

MetaCyc: 84% identical to peptidoglycan DD-endopeptidase PbpG (Escherichia coli K-12 substr. MG1655)
3.4.-.-

Predicted SEED Role

"Murein-DD-endopeptidase (EC 3.4.99.-)" in subsystem Peptidoglycan Biosynthesis (EC 3.4.99.-)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6Q7 at UniProt or InterPro

Protein Sequence (315 amino acids)

>BWI76_RS19525 D-alanyl-D-alanine endopeptidase (Klebsiella michiganensis M5al)
MTKFRVSLLSLTLLLAVPFAPQAMAKTSTAVTASQPDIASGSAMIVDLASKKIIYASQPD
LVRPMASITKVMTAMVVLDAHLPLDEMLTVDISQTPEMKGIYSRVRLNSQISRRNMLLLA
LMSSENRAAASLAHHYPGGYDAFIRAMNAKAQALGMTRTRYVEPTGLSIHNVSTARDLTK
LLIASEQYPLIGQLSTTKEDMATFAHPAYTLPFRNTNHLVYRDNWNIQLTKTGFTNAAGH
CLIMRTVINQRPVALVVMDAFGKYTHFADASRLRTWIETGKVMPVPASALSYKKQREAQM
ADAMLKGGAQTAQND