Protein Info for BWI76_RS19505 in Klebsiella michiganensis M5al

Annotation: ABC transporter substrate-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF04069: OpuAC" amino acids 26 to 300 (275 residues), 201 bits, see alignment E=1.4e-63

Best Hits

Swiss-Prot: 87% identical to YEHZ_ECOLI: Glycine betaine-binding protein YehZ (yehZ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 93% identity to eae:EAE_23810)

MetaCyc: 87% identical to glycine betaine ABC transporter periplasmic binding protein OsmF (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-283

Predicted SEED Role

"Osmoprotectant ABC transporter binding protein YehZ"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6U6 at UniProt or InterPro

Protein Sequence (305 amino acids)

>BWI76_RS19505 ABC transporter substrate-binding protein (Klebsiella michiganensis M5al)
MIKASVWSGALALAALISLPLQAAEPVKVGSKIDTEGALLGNIILQVLESHGVKTVNKIQ
LGTTPVVRGAITAGELDIYPEYTGNGAFFFKEENDPAWKNAQQGYEKVKKLDAEKNKLIW
LTPAPANNTWTIAVRQDLAEKNHLASLSDLAGYLQKGGDFKLAASAEFIERPDALPAFEK
AYGFTLKQDQLLSLAGGDTAVTIKAAAQQTSGVNAAMAYGTDGPVAALGLQTLSDPKGVQ
PIYAPTPVVREAVLKAYPQIADWLQPVFASLDEKTLQKLNASIAVEGLDAKKVAADYLQQ
KGLLK