Protein Info for BWI76_RS19475 in Klebsiella michiganensis M5al

Annotation: signal transduction histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 562 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 44 to 62 (19 residues), see Phobius details amino acids 74 to 94 (21 residues), see Phobius details amino acids 104 to 129 (26 residues), see Phobius details amino acids 140 to 162 (23 residues), see Phobius details amino acids 171 to 195 (25 residues), see Phobius details PF07694: 5TM-5TMR_LYT" amino acids 28 to 196 (169 residues), 205.3 bits, see alignment E=1.3e-64 PF13185: GAF_2" amino acids 241 to 352 (112 residues), 29 bits, see alignment E=2.7e-10 PF06580: His_kinase" amino acids 371 to 447 (77 residues), 88.4 bits, see alignment E=7.6e-29 PF02518: HATPase_c" amino acids 468 to 558 (91 residues), 27.1 bits, see alignment E=1.2e-09

Best Hits

Swiss-Prot: 85% identical to BTSS_SHIFL: Sensor histidine kinase BtsS (btsS) from Shigella flexneri

KEGG orthology group: K02478, two-component system, LytT family, sensor kinase [EC: 2.7.13.3] (inferred from 95% identity to kpn:KPN_02563)

MetaCyc: 85% identical to high-affinity pyruvate receptor (Escherichia coli K-12 substr. MG1655)
Histidine kinase. [EC: 2.7.13.3]

Predicted SEED Role

"Autolysis histidine kinase LytS" in subsystem Murein hydrolase regulation and cell death

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6I1 at UniProt or InterPro

Protein Sequence (562 amino acids)

>BWI76_RS19475 signal transduction histidine kinase (Klebsiella michiganensis M5al)
MYEFDLVLLLLQQMCVFLVIAWLMSKTRLFIPLMQVTVRLPHKLLCYVTFSIFCILGTYF
GLHIEDSIANTRAIGAVMGGLLGGPVVGGLVGLTGGLHRYSLGGMTALSCMVSTIVEGLL
GGLVHSILVKRGRPDKVFSPLTAGAITFFAEMVQMLIILLIARPFEDALHLVQSIAAPMM
VTNTVGAALFMRILLDKRAMFEKYTSAFSATALKVAASTEGILRQGFNEENSMKVAQVLI
QELDIGAVAITDRDKLLAFTGIGDDHHLPGKPISSLYTQKAIDSGEVVYADGNEVPYRCS
IHPNCKLGSTLVIPLRGENQRVIGTIKLYEAKNRLFSSINRTLGEGIAQLLSAQILAGQY
ERQKALLTQSEIKLLHAQVNPHFLFNALNTLKAVIRRDSDQAGQLVQYLSTFFRKNLKRP
AEIVTLADEIEHVNAYLQIEKARFQANLQIQMLVPEALGQHQLPAFTLQPIVENAIKHGT
SQHLGVGEITIRASQHERWLQLDIEDNAGLYQDKPSASGLGMNLVDRRLRARFGADCGIT
VTCEPECFTRVTLRLPVEDNAC