Protein Info for BWI76_RS19385 in Klebsiella michiganensis M5al

Annotation: MBL fold hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 658 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details PF00753: Lactamase_B" amino acids 128 to 221 (94 residues), 64.3 bits, see alignment E=3.1e-21 PF14863: Alkyl_sulf_dimr" amino acids 388 to 526 (139 residues), 210.2 bits, see alignment E=3e-66 PF14864: Alkyl_sulf_C" amino acids 534 to 658 (125 residues), 141.7 bits, see alignment E=3e-45 PF02036: SCP2" amino acids 564 to 638 (75 residues), 26.9 bits, see alignment E=1e-09

Best Hits

Swiss-Prot: 54% identical to BDS1_YEAST: Alkyl/aryl-sulfatase BDS1 (BDS1) from Saccharomyces cerevisiae (strain ATCC 204508 / S288c)

KEGG orthology group: None (inferred from 92% identity to eae:EAE_23700)

Predicted SEED Role

"Putative hydrolase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6F8 at UniProt or InterPro

Protein Sequence (658 amino acids)

>BWI76_RS19385 MBL fold hydrolase (Klebsiella michiganensis M5al)
MKLTPIMKSLALAGIISTLPMTSWAETSPKAAAAATKQANDALYKQLPFSDNTDFTNAHK
GFIAALPTEVIKGEQGNVIWNPQQYNFVKEGEKAPDTVNPSLWRQSQLINISGLFEVTEG
VYQIRNLDLSNMTIIEGKEGITVVDPLVSAETAKVGMDLYYKNRGNKPVVAVIYTHSHVD
HYGGVRGVVDEADVKSGKVKIYAPSGFMEAAVAENIMAGNVMSRRASYMYGNLLKPDATG
QVGAGLGTTTSAGTVTLIAPTNIIEKDGQKETIDGLTYDFMLAPGSEAPSEMLWYIEEKK
LIESAEDVTHTLHNTYSLRGAKIREPLPWSKYINAAIVRWGDKAEIIMAQHHWPTWGNEN
VVNLLKSQRDLYRYINDQTLRMANEGLTRDEIAAKFKLPDSLANTWANRGYYGSVSHDVK
ATYVLYLGWFDGNPATLDELPPEEAAKKFVDYMGGADAILKKAKEDYNQGNYRWVAQVVS
KIVFADPGNLEARNLEADALEQLGYQAESGPWRNFYLTGAQELRNGVVKGPTPNTASPDT
VRAMTPEMFFDYLAVHINGEKAGTAKAVFNIDLGNDGGKYKLELENGVLNHTADAEAKDA
DATIALERATLNKIILKEETLKQAQDKGEVKVTGDGAKLDEMLGYMDKFEFWFNIVTP