Protein Info for BWI76_RS19330 in Klebsiella michiganensis M5al

Annotation: HAD family hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 220 PF00702: Hydrolase" amino acids 3 to 180 (178 residues), 108.3 bits, see alignment E=1e-34 PF13419: HAD_2" amino acids 6 to 185 (180 residues), 110.2 bits, see alignment E=2e-35 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 83 to 185 (103 residues), 52.3 bits, see alignment E=7.3e-18 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 90 to 180 (91 residues), 27.3 bits, see alignment E=4.2e-10 PF13242: Hydrolase_like" amino acids 142 to 192 (51 residues), 26.1 bits, see alignment E=9.5e-10

Best Hits

KEGG orthology group: None (inferred from 83% identity to kpu:KP1_3757)

Predicted SEED Role

"2-deoxyglucose-6-phosphate hydrolase YniC" in subsystem 2-phosphoglycolate salvage

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6G4 at UniProt or InterPro

Protein Sequence (220 amino acids)

>BWI76_RS19330 HAD family hydrolase (Klebsiella michiganensis M5al)
MSIQAVIFDMDGVIIDSESLWRRAQIEALARWGATASDEECERLTKGKRLDDIARTWCQY
CQLDLAPQRLEEAILQRITGLIAAEGEAMRGVHEALRYFRHAGYKIALATSSSRQVISAV
LNKLSLWHYFDVISSADDEAQGKPHPAVYLTTLRKLNLDASRCLVIEDSFNGFSAARAAG
IATVIIAEDSQHARFQAAAGRYQALPELLETLTAAAEAVE