Protein Info for BWI76_RS19315 in Klebsiella michiganensis M5al

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 345 transmembrane" amino acids 19 to 39 (21 residues), see Phobius details amino acids 111 to 132 (22 residues), see Phobius details amino acids 144 to 169 (26 residues), see Phobius details amino acids 206 to 228 (23 residues), see Phobius details amino acids 267 to 293 (27 residues), see Phobius details amino acids 313 to 335 (23 residues), see Phobius details PF19300: BPD_transp_1_N" amino acids 15 to 101 (87 residues), 31.7 bits, see alignment E=1.6e-11 PF00528: BPD_transp_1" amino acids 123 to 344 (222 residues), 129.3 bits, see alignment E=1.5e-41

Best Hits

KEGG orthology group: K02033, peptide/nickel transport system permease protein (inferred from 99% identity to kpn:KPN_02537)

Predicted SEED Role

"Dipeptide transport system permease protein DppB (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6Q9 at UniProt or InterPro

Protein Sequence (345 amino acids)

>BWI76_RS19315 ABC transporter permease (Klebsiella michiganensis M5al)
MSTAILAPGSRGRRLSKRLLQVVITLFGLLLLTFTIGRVMPIDPVLAIVGPDADQSTYQQ
VYQQLGFDKSLTTQFGIYFVNLLHGDLGNALLTGKPVVDDIIRVFPATMELATMAILVGA
GLGIPLGVLAAARRNSISDYVVRIISLAGYSTPIFWVGMMGLLLFYAWLGWVGGAGRVDL
GLDGIVPRRTGLMTVDALLAGNGQVFWNAINHLILPASLLGFHSLAYISRMTRSFMLAQL
SQEFIITARVKGLTERQVIWNHAFRNILVQLLTVVALAYGALLEGAVLIETVFSWPGFGS
YLTGSLLLGDMNAVMGCVLLVGVIFVMLNLLSDMLYQFFDPRTKS