Protein Info for BWI76_RS19310 in Klebsiella michiganensis M5al

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 301 transmembrane" amino acids 39 to 61 (23 residues), see Phobius details amino acids 102 to 128 (27 residues), see Phobius details amino acids 139 to 159 (21 residues), see Phobius details amino acids 165 to 182 (18 residues), see Phobius details amino acids 221 to 246 (26 residues), see Phobius details amino acids 268 to 289 (22 residues), see Phobius details PF12911: OppC_N" amino acids 34 to 77 (44 residues), 36.8 bits, see alignment 2.9e-13 PF00528: BPD_transp_1" amino acids 118 to 299 (182 residues), 116 bits, see alignment E=1.8e-37

Best Hits

Swiss-Prot: 43% identical to DDPC_ECOLI: Probable D,D-dipeptide transport system permease protein DdpC (ddpC) from Escherichia coli (strain K12)

KEGG orthology group: K02034, peptide/nickel transport system permease protein (inferred from 98% identity to kva:Kvar_1527)

MetaCyc: 46% identical to dipeptide ABC transporter membrane subunit DppC (Escherichia coli K-12 substr. MG1655)
ABC-8-RXN [EC: 7.4.2.9]

Predicted SEED Role

"Dipeptide transport system permease protein DppC (TC 3.A.1.5.2)" in subsystem ABC transporter dipeptide (TC 3.A.1.5.2) (TC 3.A.1.5.2)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6M8 at UniProt or InterPro

Protein Sequence (301 amino acids)

>BWI76_RS19310 ABC transporter permease (Klebsiella michiganensis M5al)
MTVSLDSPLSDGTGEGRQRLRRAASRTAGFIGKMARNPLTAIGGGIIFLLLVVAIFAPLI
APYNPLVQDLNSALVAPNAQHWFGTDEFGRDIFSRLVYGSRITLYIVLLVSVTVGPLGLL
LGVSAGYFGGKVDMVLMRVTDIFISFPSLVLALAFVAALGPGLEHVVIAITLTAWPPIAR
LARAETLSLRQADFISAVRLQGASSARVLWRHIVPLCLPSVIIRITMNMAGIILTAAGLG
FLGLGAQPPEPEWGAMISSGRTYMMECWWVVTIPGLAILINSLAFNFLGDGLRDILDPRS
E