Protein Info for BWI76_RS19280 in Klebsiella michiganensis M5al

Annotation: U32 family peptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01136: Peptidase_U32
  • amino acids 77 to 343 (267 residues), 295.2 bits, E=3e-92
• PF16325: Peptidase_U32_C
  • amino acids 359 to 440 (82 residues), 75.9 bits, E=2.3e-25

Best Hits

Swiss-Prot: 94% identical to YEGQ_ECOLI: Uncharacterized protease YegQ (yegQ) from Escherichia coli (strain K12)

KEGG orthology group: K08303, putative protease [EC: 3.4.-.-] (inferred from 94% identity to eco:b2081)

Predicted SEED Role

"Putative protease"

KEGG Metabolic Maps

• Biotin metabolism
• Lysine degradation
• Peptidoglycan biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 3.4.-.-

Use Curated BLAST to search for 3.4.-.-

Sequence Analysis Tools

See A0A285B6F4 at UniProt or InterPro

Protein Sequence (453 amino acids)

>BWI76_RS19280 U32 family peptidase (Klebsiella michiganensis M5al)
MFKPELLSPAGTLKNMRYAFAYGADAVYAGQPRYSLRVRNNEFNHENLQLGINEAHALGK
KFYVVVNIAPHNAKLKTFIRDLKPVVEMGPDALIMSDPGLIMLVRENFPDMDIHLSVQAN
AVNWATVKFWQQMGLTRVILSRELSLDEIAEIRSQVPEMEIEIFVHGALCMAYSGRCLLS
GYINKRDPNQGTCTNACRWEYNVQEGKEDDVGNIVHKHEPIPVQNVEPTLGIGAPTDQVF
MIEEAKRPGEYMTAFEDEHGTYIMNSKDLRAIAHVERLTQMGVHSLKIEGRTKSHYYCAR
TAQVYRKAIDDAAAGKPFDASLLDTLENLAHRGYTEGFLRRHTHDDYQNYEHGYSVSERQ
QFVGEFTGERKGQLAAVAVKNKFSVGDSLELMTPQGNVNFTLEHMENGKGEIMPVAPGDG
HTVWLPVPEDMALQYALLMRNFAGQTTRNPHGN