Protein Info for BWI76_RS19260 in Klebsiella michiganensis M5al

Annotation: multidrug transporter subunit MdtC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 100 200 300 400 500 600 700 800 900 1025 signal peptide" amino acids 7 to 11 (5 residues), see Phobius details transmembrane" amino acids 12 to 29 (18 residues), see Phobius details amino acids 336 to 353 (18 residues), see Phobius details amino acids 360 to 384 (25 residues), see Phobius details amino acids 390 to 410 (21 residues), see Phobius details amino acids 431 to 451 (21 residues), see Phobius details amino acids 463 to 490 (28 residues), see Phobius details amino acids 528 to 545 (18 residues), see Phobius details amino acids 853 to 871 (19 residues), see Phobius details amino acids 878 to 895 (18 residues), see Phobius details amino acids 901 to 917 (17 residues), see Phobius details amino acids 953 to 970 (18 residues), see Phobius details amino acids 982 to 1008 (27 residues), see Phobius details PF00873: ACR_tran" amino acids 4 to 1008 (1005 residues), 1213.6 bits, see alignment E=0 PF03176: MMPL" amino acids 329 to 502 (174 residues), 28.7 bits, see alignment E=1e-10 amino acids 785 to 1010 (226 residues), 24.5 bits, see alignment E=1.9e-09 PF02355: SecD_SecF" amino acids 338 to 480 (143 residues), 26.1 bits, see alignment E=8.2e-10

Best Hits

Swiss-Prot: 95% identical to MDTC_KLEP3: Multidrug resistance protein MdtC (mdtC) from Klebsiella pneumoniae (strain 342)

KEGG orthology group: K07789, RND superfamily, multidrug transport protein MdtC (inferred from 62% identity to bbr:BB4430)

MetaCyc: 91% identical to multidrug efflux pump RND permease subunit MdtC (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-353; TRANS-RXN-92

Predicted SEED Role

"Multidrug transporter MdtC"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6M0 at UniProt or InterPro

Protein Sequence (1025 amino acids)

>BWI76_RS19260 multidrug transporter subunit MdtC (Klebsiella michiganensis M5al)
MKFFALFIYRPVATILLSLAITLCGILGFRLLPVAPLPQVDFPVIMISASLPGASPETMA
SSVATPLERSLGRIAGVNEMTSSSSLGSTRIILEFNFDRDINGAARDVQAAINAAQSLLP
SGMPSRPTYRKANPSDAPIMILTLTSDTWSQGELYDFASTQLAQTLAQIDGVGDVDVGGS
SLPAVRVDLNPQALFNQGVSLDAVRTAISNANVRRPQGALEDATHRWQVATNDELKTAAE
YQPLIVHYNNGAAVRLGDVANVTDSVQDVRNAGMTNAKPAILLMIRKLPEANIIETVDSI
RARLPELQRTIPASVDLQIAQDRSPTIRASLEEVEQTLVISVALVILVVFLFLRSGRATL
IPAVAVPVSLIGTFAAMYLCGFSLNNLSLMALTIATGFVVDDAIVVLENISRHLEAGMKP
LQAALQGSREVGFTVLSMSLSLVAVFLPLLLMGGLPGRLLREFAVTLSVAIGISLAVSLT
LTPMMCGWLLKSGKPHQPTRKRGFGRLLVAIQGGYGKSLKWVLKHSRLTGLVLLGTIALS
VWLYISIPKTFFPEQDTGVLMGGIQADQSISFQAMRGKLEDFMKIIREDPAVDNVTGFTG
GSRVNSGMMFITLKPRDERHETAQQIIDRLRKKLAKEPGANLFLMAVQDIRVGGRQANAS
YQYTLLSDDLAALREWEPKIRKTLAALPELADVNSDSQNNGAEMDLIYDRDTMSRLGISV
QDANNLLNNAFGQRQISTIYQPLNQYKVVMQVDPVYTQDVSALDKMFVINSEDKPIPLAY
FAKWQPANAPLSVNHQGLSAASTISFNLPTGKSLSEASDAINRAMTQIGVPSSVRGSFAG
TAQVFQETMNSQVILILAAIATVYIVLGILYESYVHPLTILSTIPSAGVGALLALELFDA
PFSLIALIGIMLLIGIVKKNAIMMVDFALEAQRNGNLPPEEAIFQACLLRFRPIMMTTLA
ALFGALPLVLSGGNGSELRQPLGITIVGGLVMSQLLTLYTTPVVYLFFDRLRLRFSRKVH
QPVSE