Protein Info for BWI76_RS19250 in Klebsiella michiganensis M5al

Annotation: multidrug transporter subunit MdtA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 414 transmembrane" amino acids 9 to 26 (18 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 59 to 387 (329 residues), 260.7 bits, see alignment E=8.2e-82 PF16576: HlyD_D23" amino acids 82 to 306 (225 residues), 35.7 bits, see alignment E=8.6e-13 PF13533: Biotin_lipoyl_2" amino acids 84 to 132 (49 residues), 58.3 bits, see alignment 7.8e-20 PF13437: HlyD_3" amino acids 195 to 296 (102 residues), 29.7 bits, see alignment E=1.3e-10

Best Hits

Swiss-Prot: 84% identical to MDTA_ECOLU: Multidrug resistance protein MdtA (mdtA) from Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC)

KEGG orthology group: K07799, putative multidrug efflux transporter MdtA (inferred from 84% identity to eum:ECUMN_2412)

MetaCyc: 83% identical to multidrug efflux pump membrane fusion protein MdtA (Escherichia coli K-12 substr. MG1655)
TRANS-RXN-352; TRANS-RXN-353; TRANS-RXN-92

Predicted SEED Role

"Probable RND efflux membrane fusion protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6X0 at UniProt or InterPro

Protein Sequence (414 amino acids)

>BWI76_RS19250 multidrug transporter subunit MdtA (Klebsiella michiganensis M5al)
MKGSNKSRWAAVLVVAIIAGAAYWFWQGREAANAPSATAAGPGPGGGRAGRFGAALAPVQ
AATAASEAVPRYLSGLGTVTAANTVTVRSRVDGQLLAIHFTEGQQVKAGDLLAEIDPSQF
KVALAQAEGQLAKDRATLANARRDLARYQQLVKTNLVSRQELDTQQSLVSETQGTIKADE
AAVASAQLQLNWSRITAPIDGRVGLKQVDIGNQISSGDTTGIVVLTQTHPIDVVFTLPEN
QIATVVQAQKAGKKLVVEAWDRTNKQKISEGSLLSLDNQIDATTGTIKLKARFTNLDDAL
FPNQFVNARMLVDTEQNAVVIPTAALQMGNEGHFVWVLNDENKVSKHTVTPGIQDSLKVV
INAGLSAGDRVVTDGIDRLTEGAKVEVVEAQNAASAAEPAKATSREYGKKGARS