Protein Info for BWI76_RS19245 in Klebsiella michiganensis M5al

Annotation: dimethylargininase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 PF19420: DDAH_eukar" amino acids 33 to 181 (149 residues), 30.1 bits, see alignment E=2.8e-11 PF02274: ADI" amino acids 107 to 177 (71 residues), 23.4 bits, see alignment E=2.9e-09

Best Hits

Swiss-Prot: 41% identical to DDAH_PSEAE: N(G),N(G)-dimethylarginine dimethylaminohydrolase (PA1195) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01482, dimethylargininase [EC: 3.5.3.18] (inferred from 87% identity to srs:SerAS12_2371)

Predicted SEED Role

"NG,NG-dimethylarginine dimethylaminohydrolase 1 (EC 3.5.3.18)" in subsystem Dimethylarginine metabolism (EC 3.5.3.18)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.3.18

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6J8 at UniProt or InterPro

Protein Sequence (253 amino acids)

>BWI76_RS19245 dimethylargininase (Klebsiella michiganensis M5al)
MHFTQAIARLPAATCGAGQTTAQLGAPDIAATTRQFLAYVETLLQLGLKVTVLPPAADYP
DAHFVEDTAVVMPELAVITHPGAPSRQGEVDTIAPVLAGFRPLARMSERGHMDGGDVLLV
DKQFFIGLTARTDEQGIREFAAAVEPHGYQVAAIEVSAGLHLKSIVNYVGRNTLLLTEGY
VNHPAFSGFNSIVIPEEEAYAGNTLWINDTLITPQGYPHTLGEISKLGMPIVQLDTSEFK
KMDGGLTCLSLRF