Protein Info for BWI76_RS19235 in Klebsiella michiganensis M5al

Annotation: polar amino acid ABC transporter inner membrane subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 230 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 61 to 83 (23 residues), see Phobius details amino acids 90 to 108 (19 residues), see Phobius details amino acids 148 to 172 (25 residues), see Phobius details amino acids 191 to 212 (22 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 6 to 114 (109 residues), 55.4 bits, see alignment E=3.5e-19 PF00528: BPD_transp_1" amino acids 29 to 219 (191 residues), 81.9 bits, see alignment E=2.5e-27

Best Hits

Swiss-Prot: 37% identical to OCCQ_RHIRD: Octopine transport system permease protein OccQ (occQ) from Rhizobium radiobacter

KEGG orthology group: None (inferred from 86% identity to srr:SerAS9_2373)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisQ (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6J9 at UniProt or InterPro

Protein Sequence (230 amino acids)

>BWI76_RS19235 polar amino acid ABC transporter inner membrane subunit (Klebsiella michiganensis M5al)
MVADYLPLLLRGAALSLCVMLSSLLVALLLGLINSLIKLFGPPWLRLFSTAYTTLVRGIP
ELVIMLLLFFGGEMLVNLLLGLVGLGPVRFNTFISGVLAIGFVFGAYYTETFRGAFLTVD
SGQTEAAQAYGMRPWTVFRRVMLPQMLSFAIPGINNNWLGLMKASALVSILGLEDMVWLA
EQAGRATQKPFLFYFLVSLIYMVITALSSWLFSRLAKRYALRSSTAGVAL