Protein Info for BWI76_RS19230 in Klebsiella michiganensis M5al

Annotation: polar amino acid ABC transporter inner membrane subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 transmembrane" amino acids 29 to 52 (24 residues), see Phobius details amino acids 64 to 84 (21 residues), see Phobius details amino acids 103 to 127 (25 residues), see Phobius details amino acids 173 to 199 (27 residues), see Phobius details amino acids 206 to 228 (23 residues), see Phobius details TIGR01726: amino ABC transporter, permease protein, 3-TM region, His/Glu/Gln/Arg/opine family" amino acids 22 to 127 (106 residues), 47.4 bits, see alignment E=1.1e-16 PF00528: BPD_transp_1" amino acids 40 to 233 (194 residues), 59.5 bits, see alignment E=1.9e-20

Best Hits

KEGG orthology group: None (inferred from 86% identity to spe:Spro_2399)

Predicted SEED Role

"Histidine ABC transporter, permease protein HisM (TC 3.A.1.3.1)" in subsystem Arginine and Ornithine Degradation (TC 3.A.1.3.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6E5 at UniProt or InterPro

Protein Sequence (241 amino acids)

>BWI76_RS19230 polar amino acid ABC transporter inner membrane subunit (Klebsiella michiganensis M5al)
MNLQTFIDAIPSFLWSDGNGAASGLAVTAELFLLSIVPGMALAIAMAVGQVYGPRGLALP
IRAFTYFFRSTPLYLQLMLIYYGLSQFDIVQTGWMNDQPFWLLFRDATFCATLALVLNTA
AYVAELLAGMMVTFPRQEWIAGEAYGMGKWQIIRRLVLPATLRRGIPALNNEMVFLLHAT
SLASTVTLLDITGVARAFYAMTYSPFIPFLMAAALYLLCTFLLIFTFARAERRWLAFIRR
G