Protein Info for BWI76_RS19205 in Klebsiella michiganensis M5al

Annotation: putative proline iminopeptidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 299 TIGR01250: proline-specific peptidase" amino acids 13 to 290 (278 residues), 268.8 bits, see alignment E=3.3e-84 PF00561: Abhydrolase_1" amino acids 31 to 279 (249 residues), 105.8 bits, see alignment E=4.5e-34 PF12697: Abhydrolase_6" amino acids 32 to 282 (251 residues), 71.3 bits, see alignment E=2.8e-23 PF12146: Hydrolase_4" amino acids 48 to 278 (231 residues), 54.3 bits, see alignment E=1.8e-18

Best Hits

KEGG orthology group: K01259, proline iminopeptidase [EC: 3.4.11.5] (inferred from 75% identity to pfs:PFLU1631)

Predicted SEED Role

"Proline iminopeptidase (EC 3.4.11.5)" in subsystem Proline, 4-hydroxyproline uptake and utilization (EC 3.4.11.5)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.4.11.5

Use Curated BLAST to search for 3.4.11.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6B8 at UniProt or InterPro

Protein Sequence (299 amino acids)

>BWI76_RS19205 putative proline iminopeptidase (Klebsiella michiganensis M5al)
MWSEIAPDQYHNIAVEGYNVVAYQFGDGEETVLCLNGGPGLPCDYLREAHSCLKQHGYRV
IAFDQLGTGKSDRPDDASLWTMARYVREVETVRQALGLGQVHLLGHSWGGWLAIEVALHH
PGAIRSLILENTVADMPHLVQELNRLRGALGPETVAMMQRYEALGWLDHPAYQAAITLLN
YRHVCRLDVWPEPVTRSLGDWNMGPYTTMQGPNEFLYTGNLKNWNRSAELASIRAPCLIT
SGQHDELTPACALKMKQGLANAEIAIFANSSHMPFYEEPQAYYPVLLDFLARQRDAGGC