Protein Info for BWI76_RS19190 in Klebsiella michiganensis M5al

Annotation: oligopeptide/dipeptide ABC transporter ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 326 PF00005: ABC_tran" amino acids 20 to 180 (161 residues), 114.1 bits, see alignment E=1.2e-36 PF13304: AAA_21" amino acids 135 to 215 (81 residues), 31.2 bits, see alignment E=3.5e-11 TIGR01727: oligopeptide/dipeptide ABC transporter, ATP-binding protein, C-terminal domain" amino acids 230 to 315 (86 residues), 71.1 bits, see alignment E=3.3e-24 PF08352: oligo_HPY" amino acids 232 to 295 (64 residues), 70.7 bits, see alignment E=1.6e-23

Best Hits

Swiss-Prot: 53% identical to Y4TR_SINFN: Probable peptide ABC transporter ATP-binding protein y4tR (NGR_a01410) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K02031, peptide/nickel transport system ATP-binding protein (inferred from 80% identity to ddc:Dd586_2916)

MetaCyc: 49% identical to murein tripeptide ABC transporter / oligopeptide ABC transporter ATP binding subunit OppD (Escherichia coli K-12 substr. MG1655)
3.6.3.23-RXN [EC: 7.4.2.6]; 7.4.2.6 [EC: 7.4.2.6]

Predicted SEED Role

"Oligopeptide transport system permease protein OppB (TC 3.A.1.5.1)" in subsystem ABC transporter oligopeptide (TC 3.A.1.5.1) (TC 3.A.1.5.1)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 7.4.2.6

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6C0 at UniProt or InterPro

Protein Sequence (326 amino acids)

>BWI76_RS19190 oligopeptide/dipeptide ABC transporter ATPase (Klebsiella michiganensis M5al)
MSLLKVNRLAVTGGEDIALVDNVSFTLEAGEMLGLVGESGSGKTVTCRALMRLLPGDGLR
ISGGEVVLDGRDILPLSEGQMSAVRGREIGMIFQNPTSHLNPVMTIGEQIAESRRLHFAA
NRRQAREDALALLRQVGIPDPQNRLNSYPHEFSGGMRQRAMIAVALASEPRLLIADEPTT
ALDVTVQMQILRLLSDLRAELGLAVIMITHDLGVVAQTCDRIAVMYGGRLCEVGDKREVL
AGPLHPYTRGLIDCQPASEGGRGRLTIIDGQPPSADHFPSGCRFHPRCRRADEACLQPPP
LHYGQDRHSHAVACHHRLPTLTRQEG