Protein Info for BWI76_RS19165 in Klebsiella michiganensis M5al

Annotation: chemotaxis protein CheY

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 232 PF00072: Response_reg" amino acids 5 to 113 (109 residues), 71.2 bits, see alignment E=8e-24 PF00486: Trans_reg_C" amino acids 158 to 213 (56 residues), 44.2 bits, see alignment E=1.7e-15

Best Hits

KEGG orthology group: K07660, two-component system, OmpR family, response regulator PhoP (inferred from 69% identity to kpn:KPN_02523)

Predicted SEED Role

"Response regulator receiver:Transcriptional regulatory protein-like"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6N0 at UniProt or InterPro

Protein Sequence (232 amino acids)

>BWI76_RS19165 chemotaxis protein CheY (Klebsiella michiganensis M5al)
MTLRVAIIEDSADLLDELLAFLRHRGFDAWGVGSAEAFWRQLHRDPVDIVLIDIGLPGED
GFSVLDYLHEIGQFGLVVITARGHEQDRLQALNAGADLYLIKPVNFSDLAESIHALGSRL
RQQQPAEGVNPAPSAERSAPSHWILQSERLVAPSGRILPLTQQEYRLLEVLMRNRNEVCS
KVDLHTSLFTDEGEPELHRIDVVISRLRHKARLQGITLPIRAIFGKGLAFLS