Protein Info for BWI76_RS19160 in Klebsiella michiganensis M5al

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 635 signal peptide" amino acids 1 to 17 (17 residues), see Phobius details transmembrane" amino acids 174 to 194 (21 residues), see Phobius details amino acids 201 to 221 (21 residues), see Phobius details amino acids 236 to 256 (21 residues), see Phobius details amino acids 269 to 289 (21 residues), see Phobius details amino acids 295 to 315 (21 residues), see Phobius details amino acids 325 to 349 (25 residues), see Phobius details amino acids 359 to 378 (20 residues), see Phobius details PF07696: 7TMR-DISMED2" amino acids 27 to 160 (134 residues), 53.7 bits, see alignment E=5.5e-18 PF07695: 7TMR-DISM_7TM" amino acids 173 to 369 (197 residues), 34.3 bits, see alignment E=5.8e-12 PF00512: HisKA" amino acids 405 to 467 (63 residues), 37.7 bits, see alignment E=4.5e-13 PF02518: HATPase_c" amino acids 522 to 628 (107 residues), 94.7 bits, see alignment E=1.2e-30 PF14501: HATPase_c_5" amino acids 524 to 613 (90 residues), 22.9 bits, see alignment E=1.7e-08

Best Hits

KEGG orthology group: None (inferred from 72% identity to kpe:KPK_1644)

Predicted SEED Role

"FIG00732558: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6K2 at UniProt or InterPro

Protein Sequence (635 amino acids)

>BWI76_RS19160 histidine kinase (Klebsiella michiganensis M5al)
MCGVIISLQWWAPARAEVRQLGIDIPVYWYADASDTMPLDAFLSLPQEALKTAPLIPSFG
YSSKTYWLRTSLPAAWFAGEQRWLQLGPSFVDRLSVFYRPCGSDAPWKQKEFGDHASARD
NDLDYRESVLILPPPPTAAGYEMVFRLQSTSTLILLATLSSPQEFVRSATLDTAFWSFYF
GLAVIASGIALWLAVALRRRLLWGICLFSLNYPLVAALHGYPEWLFGDALLPVQDYMISC
LSLVSYATALWLHSEVFDLKKNMPRLHQLLLAAIALNIVLQISIPLGFYGQAMQIEAGIF
FIAAPILLITSWMLWRRKAVDINTLLLGLLPPVYVVSAGLALLSIHGVIPFHNMVYSTWQ
YALIIHIVTVLIIAVLRVRAENRTLVRKQQLARELQIEREASFHQRQFMGMVAHEFRTPL
AILQAALENQRLSPATVTQSLRLDRMQRATTRLVQLTDNCLADARLSSRDLHADKQDAEL
LPVIHMAATVVDLSLNHYLNVTLEGQTVGPQSPSPVLFIDSGLLCIAIANLLDNAVKYAA
AGEIRIEIYQQEKHVELRIGDRGPGIPPEQVEHIYERYRRGETHTTTPAGTGLGLYVARQ
IIQAHGGDLWLAENSSAGCEFALTLPLTGQQKDKP