Protein Info for BWI76_RS19150 in Klebsiella michiganensis M5al

Annotation: formate dehydrogenase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01582: formate dehydrogenase, beta subunit
  • amino acids 7 to 289 (283 residues), 482.7 bits, E=1.5e-149
• PF12838: Fer4_7
  • amino acids 38 to 114 (77 residues), 29.9 bits, E=3.2e-10
• PF13247: Fer4_11
  • amino acids 92 to 188 (97 residues), 87.2 bits, E=3.5e-28
• PF13237: Fer4_10
  • amino acids 94 to 144 (51 residues), 34.1 bits, 1.1e-11
• PF00037: Fer4
  • amino acids 130 to 147 (18 residues), 22.7 bits, see alignment (E = 3.4e-08)
• PF13187: Fer4_9
  • amino acids 132 to 184 (53 residues), 28.5 bits, 6.2e-10
• PF09163: Form-deh_trans
  • amino acids 246 to 288 (43 residues), 73.4 bits, 5e-24

Best Hits

Swiss-Prot: 93% identical to FDOH_ECOL6: Formate dehydrogenase-O iron-sulfur subunit (fdoH) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K00124, formate dehydrogenase, beta subunit [EC: 1.2.1.2] (inferred from 96% identity to cko:CKO_03118)

MetaCyc: 93% identical to formate dehydrogenase O subunit beta (Escherichia coli K-12 substr. MG1655)
FORMATEDEHYDROG-RXN [EC: 1.17.5.3]

Predicted SEED Role

"Formate dehydrogenase O beta subunit (EC 1.2.1.2)" in subsystem Formate dehydrogenase or Formate hydrogenase (EC 1.2.1.2)

MetaCyc Pathways

• formate to dimethyl sulfoxide electron transfer (2/2 steps found)
• nitrate reduction III (dissimilatory) (2/2 steps found)
• formate oxidation to CO₂ (1/1 steps found)
• purine nucleobases degradation II (anaerobic) (17/24 steps found)
• formate to trimethylamine N-oxide electron transfer (1/2 steps found)
• formate to nitrite electron transfer (1/3 steps found)
• oxalate degradation VI (1/4 steps found)
• oxalate degradation III (1/5 steps found)
• superpathway of C1 compounds oxidation to CO₂ (4/12 steps found)
• purine nucleobases degradation I (anaerobic) (6/15 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.2.1.2

Use Curated BLAST to search for 1.17.5.3 or 1.2.1.2

Protein Sequence (300 amino acids)

>BWI76_RS19150 formate dehydrogenase subunit beta (Klebsiella michiganensis M5al)
MAYQSQDIIRRSATNGFTPAPRARDHQEEVAKLIDVTTCIGCKACQVACSEWNDIRDEVG
HNVGVYDNPADLTAKSWTVMRFSEVEQNDKLEWLIRKDGCMHCADPGCLKACPAEGAIIQ
YANGIVDFRSEQCIGCGYCIAGCPFNVPRLNPEDNRVYKCTLCVDRVNVGQEPACVKTCP
TGAIHFGSKEEMKTLAGERVAELKTRGYDNAGLYDPAGVGGTHVMYVLHHADKPNLYHGL
PENPEISATVKFWKGIWKPLAAVGFAATFAASIFHYVGVGPNRAEEEEDNLDEEKDEVRK