Protein Info for BWI76_RS19120 in Klebsiella michiganensis M5al

Annotation: dCTP deaminase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02274: deoxycytidine triphosphate deaminase
  • amino acids 2 to 190 (189 residues), 221.5 bits, E=3.3e-70
• PF06559: DCD
  • amino acids 3 to 125 (123 residues), 30.2 bits, E=2.2e-11
• PF00692: dUTPase
  • amino acids 80 to 185 (106 residues), 32.5 bits, E=6.4e-12

Best Hits

Swiss-Prot: 95% identical to DCD_SALG2: dCTP deaminase (dcd) from Salmonella gallinarum (strain 287/91 / NCTC 13346)

KEGG orthology group: K01494, dCTP deaminase [EC: 3.5.4.13] (inferred from 94% identity to eco:b2065)

MetaCyc: 94% identical to dCTP deaminase (Escherichia coli K-12 substr. MG1655)
dCTP deaminase. [EC: 3.5.4.13]

Predicted SEED Role

"Deoxycytidine triphosphate deaminase (EC 3.5.4.13)" (EC 3.5.4.13)

MetaCyc Pathways

• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (E. coli) (14/14 steps found)
• pyrimidine deoxyribonucleotides de novo biosynthesis II (7/7 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.13

Sequence Analysis Tools

See A0A285B6C4 at UniProt or InterPro

Protein Sequence (193 amino acids)

>BWI76_RS19120 dCTP deaminase (Klebsiella michiganensis M5al)
MRLCDRDIETWLDEGRLAINPRPPVERINGATVDVRLGNKFRTFRGHTAGFIDLSGPKAE
VSAALDRVMSEEIVLPDGEAFFLHPGELALAVTFESVTLPPDLVGWLDGRSSLARLGLMV
HVTAHRIDPGWSGCIVLEFYNSGKLPLALRPGMLIGALSFEPLSGPAVRPYNRREDAKYR
DQQGAVASRIDKD