Protein Info for BWI76_RS19100 in Klebsiella michiganensis M5al

Annotation: putative acid phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 transmembrane" amino acids 6 to 28 (23 residues), see Phobius details amino acids 39 to 60 (22 residues), see Phobius details amino acids 71 to 90 (20 residues), see Phobius details amino acids 97 to 116 (20 residues), see Phobius details amino acids 128 to 145 (18 residues), see Phobius details amino acids 157 to 175 (19 residues), see Phobius details PF01569: PAP2" amino acids 72 to 147 (76 residues), 38.6 bits, see alignment E=4.4e-14

Best Hits

Swiss-Prot: 71% identical to YC02_KLEPN: Uncharacterized 22.5 kDa protein in cps region from Klebsiella pneumoniae

KEGG orthology group: None (inferred from 71% identity to eae:EAE_23540)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6T7 at UniProt or InterPro

Protein Sequence (209 amino acids)

>BWI76_RS19100 putative acid phosphatase (Klebsiella michiganensis M5al)
MNWQVVTFFGDSTVLLPSAAVLFIVLFLRKDSKQLAWHWALLFGITGAIVCASKLAFMGW
GIGIRELDFTGFSGHTALSSAFWPILLWLLCARATPALRFTAVVFGYALAGLVGYSRLMV
HAHSTSEVIAGLLLGAAGSAAFLLLQSRVRDTYTAQLSFGSLASMLIIPALLLNTGAKAP
TQSLLGEIAVKLGPLEKPFTRVDLHKGFY