Protein Info for BWI76_RS19095 in Klebsiella michiganensis M5al

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF14052: Caps_assemb_Wzi" amino acids 91 to 467 (377 residues), 376.5 bits, see alignment E=8.1e-117

Best Hits

Swiss-Prot: 89% identical to YC03_KLEPN: Uncharacterized 55.8 kDa protein in cps region from Klebsiella pneumoniae

KEGG orthology group: None (inferred from 91% identity to eae:EAE_23535)

Predicted SEED Role

"FIG00732100: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (477 amino acids)

>BWI76_RS19095 hypothetical protein (Klebsiella michiganensis M5al)
MIKIARIALALGLLTSASSLAYASGLVMNDNELRNDLAWLSDRGVIHLSLSTWPLSQEEI
NRALKKAKPSYSSEQVVLARINQRLDSLKADFRVSGYTSTDKPGTPQGFGQNQPADSSLS
LAFNNSGEWWDVHLQGNVEGDERISNGSRFNANGAYGAVKFWNQWLSFGQMPQWWGPGYE
GSLIRGDAMRPMTGVLMQRAEQAAPETWWLRWIGPWQYQISASQMNQYTAVPHTKIIGGR
LTFSPFQSLELGASRIMQWGGEGRPESFSSFWDGLAGKDNTGTANEPGNQLAGFDFKFKL
EPTLGWPISFYGQLIGEDEAGYLPSANMFLGGVEGHHGWGKDAINWYVEAHDTRSNMDRL
NYSYNHHIYTDGYYQQGYPLGDAMGGDGQLYAGKVELVTEDNQRWSARLAYAKVNPRSQS
INKAFPQSDTLKGVQLGWSGDVYKSVRLNTSLWYTDADNSDSDDVGASAGIEIPFNL