Protein Info for BWI76_RS19085 in Klebsiella michiganensis M5al

Annotation: protein-tyrosine-phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 73% identical to YOR5_KLEPN: Putative low molecular weight protein-tyrosine-phosphatase from Klebsiella pneumoniae

KEGG orthology group: K01104, protein-tyrosine phosphatase [EC: 3.1.3.48] (inferred from 81% identity to kpn:KPN_02511)

MetaCyc: 60% identical to phosphotyrosine-protein phosphatase Etp (Escherichia coli K-12 substr. MG1655)
Protein-tyrosine-phosphatase. [EC: 3.1.3.48]

Predicted SEED Role

"Low molecular weight protein-tyrosine-phosphatase Wzb (EC 3.1.3.48)" in subsystem Colanic acid biosynthesis (EC 3.1.3.48)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.48

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (144 amino acids)

>BWI76_RS19085 protein-tyrosine-phosphatase (Klebsiella michiganensis M5al)
MFDSILVVCTGNICRSPIGERFLRRALPHKKIDSAGTGALVDHSADESAIKIAELHGLSL
DGHKGKQFTSSLSRRYDLILVMEKAHIEQIGHIAPEARGKTMLFGQWLGQRDIPDPYRKS
EEAFASVYQLIEQAGLRWVEKLGA