Protein Info for BWI76_RS19080 in Klebsiella michiganensis M5al

Annotation: tyrosine autokinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 720 transmembrane" amino acids 31 to 54 (24 residues), see Phobius details amino acids 423 to 447 (25 residues), see Phobius details PF02706: Wzz" amino acids 14 to 105 (92 residues), 92.1 bits, see alignment E=5.7e-30 PF23607: WZC_N" amino acids 111 to 200 (90 residues), 55.2 bits, see alignment E=2.3e-18 PF13807: GNVR" amino acids 365 to 445 (81 residues), 113 bits, see alignment E=1.3e-36 TIGR01007: capsular exopolysaccharide family" amino acids 507 to 708 (202 residues), 158.4 bits, see alignment E=8.5e-51 PF01656: CbiA" amino acids 529 to 570 (42 residues), 27.3 bits, see alignment 7.7e-10 PF13614: AAA_31" amino acids 537 to 650 (114 residues), 47.6 bits, see alignment E=4.5e-16

Best Hits

KEGG orthology group: K00903, protein-tyrosine kinase [EC: 2.7.10.-] (inferred from 78% identity to kpn:KPN_02510)

Predicted SEED Role

"Tyrosine-protein kinase Wzc (EC 2.7.10.2)" in subsystem Colanic acid biosynthesis (EC 2.7.10.2)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.7.10.- or 2.7.10.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (720 amino acids)

>BWI76_RS19080 tyrosine autokinase (Klebsiella michiganensis M5al)
MSSITNKTAAKETDEIDLGRLVGELIDHRKLIISVTALFTLIALIYALFATPIYQADALI
QVEQKQGNAILSNLSQMLPNSQPSSAPEITLLQSRMILGKTVSDLNLQAKAVQNYFPVFG
KGWARLMGDKPGRISITRLYLPVNNDEPPEIKLTVQDDKHYLVKYNDRTIKGTVGELLDD
KDLSLKVNSIESEPGTEFTILFVDKLKAITDLQNVFTVVDQGKDTGMLTLSLVGDDSELI
AKIVDSISNNYLAQNIARQAAQDAKSLDFLNLQLPKVRGDLDIAEDKLNQYRRQNDSVDL
SLEAKSVLEQIVNVDNQLNELTFRESEISQLYTKEHPTYKALMEKRKTLQDEKAKLNQRV
SSMPKTQQEILRLSRDVDSGQAVYMQLLNRQQELSISKSSAIGNVRIIDNAVTQPKPVKP
KKIIVLLAGIVFGLFVSIGLVLLRVFFRRGIESPEQLEEIGINVYASIPVSEAFAKKMVQ
TPGWRKKEKSEYQGFLAVENPADLAIEAIRGLRTSLHFAMMEARNNVLMISGASPNAGKT
FVSTNLSAIISQTGKKVLLIDTDMRKGYTHKLFSVSNDNGLSDILSGKIEINKAVKNISN
VGFDFISRGAVPPNPAELLMHRRFGELISWASQNYDIVILDTPPILAVTDAAIIGHYAGT
TLLVARFEQNTAKELEVSFKRFEQSGVVVKGCILNGVVKKASSYYGYGYSHYGYTYTDDK