Protein Info for BWI76_RS19070 in Klebsiella michiganensis M5al
Annotation: rhamnosyltransferase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 50% identical to RFBN_SALTY: O antigen biosynthesis rhamnosyltransferase RfbN (rfbN) from Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720)
KEGG orthology group: K12992, rhamnosyltransferase [EC: 2.4.1.-] (inferred from 67% identity to ecx:EcHS_A2189)MetaCyc: 48% identical to dTDP-Rha:alpha-D-Gal-diphosphoundecaprenol alpha-1,3-rhamnosyltransferase (Salmonella enterica salamae serovar 1,9,12,46,27:l,w:e,n,x)
RXN-21844 [EC: 2.4.1.377]
Predicted SEED Role
"O antigen biosynthesis rhamnosyltransferase rfbN (EC 2.4.1.-)" (EC 2.4.1.-)
MetaCyc Pathways
- Salmonella enterica serotype O:3,10 O antigen biosynthesis (2/5 steps found)
- Porphyromonas gingivalis O-LPS antigen biosynthesis (2/6 steps found)
- Salmonella enterica serotype O:2 O antigen biosynthesis (2/6 steps found)
- Salmonella enterica serotype O:4 O antigen biosynthesis (group B1) (2/6 steps found)
- Salmonella enterica serotype O:9 O antigen biosynthesis (2/6 steps found)
- Salmonella enterica serotype O:9,46 O antigen biosynthesis (2/6 steps found)
- Salmonella enterica serotype O:9,46,27 O antigen biosynthesis (2/9 steps found)
KEGG Metabolic Maps
- Anthocyanin biosynthesis
- Carotenoid biosynthesis - General
- Flavone and flavonol biosynthesis
- Flavonoid biosynthesis
- Fructose and mannose metabolism
- Glycerolipid metabolism
- Glycosphingolipid biosynthesis - ganglio series
- Glycosphingolipid biosynthesis - globo series
- Glycosphingolipid biosynthesis - lacto and neolacto series
- Glycosylphosphatidylinositol(GPI)-anchor biosynthesis
- High-mannose type N-glycan biosynthesis
- Keratan sulfate biosynthesis
- Lipopolysaccharide biosynthesis
- N-Glycan biosynthesis
- O-Glycan biosynthesis
- O-Mannosyl glycan biosynthesis
- Peptidoglycan biosynthesis
- Sphingolipid metabolism
- Zeatin biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 2.4.1.-
Use Curated BLAST to search for 2.4.1.- or 2.4.1.377
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (302 amino acids)
>BWI76_RS19070 rhamnosyltransferase (Klebsiella michiganensis M5al) MKFYIAIPTYNGGEIWQTAASEIKKHAPLNTVVQVIDSSSSDNTVSVAISNGFNVLTIPG NEFNHGGTRNLAVKDFDDYDVVIFLTQDAIPQPNFVENILSAFENEDVVCAYGRQLPHTD ANPLAIHARSFSYPEKGYIADKCKIPNMGLKTFFMSNSFSAYRLSAFKELKGFPENTILC EDMFFTAKSVLAGFKVAYVSDAIVKHSHNYTPIEEFKRYFDIGVFHTDEPWIRENSGGAA GEGKKYMISEFKFLLQKAPLWIPYACISNFMKITGYKLGQKYKIMPMKLIKLFSMHKRYW KL