Protein Info for BWI76_RS18990 in Klebsiella michiganensis M5al

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 255 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 64 to 91 (28 residues), see Phobius details amino acids 111 to 130 (20 residues), see Phobius details amino acids 136 to 164 (29 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details amino acids 226 to 245 (20 residues), see Phobius details PF01061: ABC2_membrane" amino acids 12 to 211 (200 residues), 43 bits, see alignment E=2e-15

Best Hits

Swiss-Prot: 93% identical to RFBA2_KLEPN: O-antigen export system permease protein RfbA (rfbA) from Klebsiella pneumoniae

KEGG orthology group: K09690, lipopolysaccharide transport system permease protein (inferred from 92% identity to ecm:EcSMS35_2268)

Predicted SEED Role

"O-antigen export system permease protein RfbD"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B680 at UniProt or InterPro

Protein Sequence (255 amino acids)

>BWI76_RS18990 ABC transporter permease (Klebsiella michiganensis M5al)
MKYNLGYLFDLLVVITNKDLKVRYKSSVFGYLWSIANPLLFAMIYYFIFKLIMRVQIPNY
TLFLITGLFPWQWFASSATNSLFSFIANAQIIKKTVFPRSVIPLSNVMMEGLHFLCTIPV
IVAFLFVYGMRPSLSWLWGIPLIAIGQVIFTFGISIIFSTLNLFFRDLERFVTLGIMLMF
YCTPILYASDMIPAKYSWVIDYNPLASMILSWRNLFMDGVLNYEHISVLYLTGIVLTVIG
LSIFNKLKYRFAEIL