Protein Info for BWI76_RS18975 in Klebsiella michiganensis M5al

Annotation: UDP-galactopyranose mutase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00031: UDP-galactopyranose mutase
  • amino acids 5 to 367 (363 residues), 322.3 bits, E=2.1e-100
• PF01266: DAO
  • amino acids 6 to 43 (38 residues), 31.1 bits, 4.6e-11
• PF13454: NAD_binding_9
  • amino acids 8 to 78 (71 residues), 26.2 bits, E=1.7e-09
• PF13450: NAD_binding_8
  • amino acids 8 to 74 (67 residues), 73.2 bits, E=4.4e-24
• PF01593: Amino_oxidase
  • amino acids 13 to 162 (150 residues), 30.6 bits, E=5.7e-11
• PF03275: GLF
  • amino acids 150 to 349 (200 residues), 263.6 bits, E=3e-82

Best Hits

Swiss-Prot: 90% identical to GLF8_KLEPN: Probable UDP-galactopyranose mutase (rfbD) from Klebsiella pneumoniae

KEGG orthology group: K01854, UDP-galactopyranose mutase [EC: 5.4.99.9] (inferred from 89% identity to ecm:EcSMS35_2265)

MetaCyc: 59% identical to dTDP-fucopyranose mutase (Escherichia coli O52)
RXN-14533 [EC: 5.4.99.59]

Predicted SEED Role

"UDP-galactopyranose mutase (EC 5.4.99.9)" in subsystem LOS core oligosaccharide biosynthesis or linker unit-arabinogalactan synthesis (EC 5.4.99.9)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (11/11 steps found)
• dTDP-β-D-fucofuranose biosynthesis (3/4 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (9/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.99.59 or 5.4.99.9

Sequence Analysis Tools

See A0A285B6I2 at UniProt or InterPro

Protein Sequence (384 amino acids)

>BWI76_RS18975 UDP-galactopyranose mutase (Klebsiella michiganensis M5al)
MNSKNILIVGAGFSGAVIARQLAEQGHRIRIIDQRDHIGGNSYDARDPQTDVMVHVYGPH
IFHTDNETVWNYVTQHAEMMPYVNRVKATVNGQVFSLPINLHTINQFFAKTCSPDEARAL
IAEKGDSSIQEPKTFEEQALRFIGKELYEAFFKGYTIKQWGMEPSQLPASILKRLPVRFN
YDDNYFNHRFQGMPKLGYTKMIESIANHENITIELQQSFNAEEREKYDHVFYSGPLDAFY
SYQYGRLGYRTLDFEKFTRQGDYQGCAVMNYCSLDVPYTRITEHKYFSPWETHEGSVCYK
EYSRECGENDIPYYPIRQMGEMALLDKYLSLAESEKNITFVGRLGTYRYLDMDVTIAEAL
NTAEKYLSSLDNHEAMPVFTVSVR