Protein Info for BWI76_RS18970 in Klebsiella michiganensis M5al

Annotation: putative glycosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 transmembrane" amino acids 245 to 267 (23 residues), see Phobius details PF13641: Glyco_tranf_2_3" amino acids 3 to 215 (213 residues), 38.6 bits, see alignment E=1.6e-13 PF00535: Glycos_transf_2" amino acids 4 to 110 (107 residues), 63.3 bits, see alignment E=4.2e-21 PF13704: Glyco_tranf_2_4" amino acids 19 to 91 (73 residues), 27.6 bits, see alignment E=4.8e-10

Best Hits

KEGG orthology group: K07011, (no description) (inferred from 70% identity to ecm:EcSMS35_2264)

Predicted SEED Role

"Putative glycosyl transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B692 at UniProt or InterPro

Protein Sequence (297 amino acids)

>BWI76_RS18970 putative glycosyltransferase (Klebsiella michiganensis M5al)
MNCSALIVTYNRLEKLKVTIANTVKLNFTAIMVVNNGSTDGTQEWLATLSDPRVIVLNLP
SNTGGAGGFKAGSQYLCDNVDSDWVFFYDDDAWPESDALEKFAHLDKANCRVFTALVKDL
RGQPCSMNIPFAKVPSSFIDTLRYIKKPAEFLPLISRSTAVQTVSFVGMIIQRDLLRKNI
HNIHDELFLYFDDLYFGYQLTLDGEEIRYSPEVVFSHDVSIQGKCVFPEWKVYYLCRNLI
LAKRIFPRVAIFSRLSILLRLIKYVSILPWQRNKLLYFKCLRRGVIHGVKGISGKNH