Protein Info for BWI76_RS18965 in Klebsiella michiganensis M5al

Annotation: bifunctional galactosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 377 PF13477: Glyco_trans_4_2" amino acids 3 to 127 (125 residues), 64.5 bits, see alignment E=3.2e-21 PF13439: Glyco_transf_4" amino acids 24 to 121 (98 residues), 29.6 bits, see alignment E=1.6e-10 PF00534: Glycos_transf_1" amino acids 192 to 353 (162 residues), 94.1 bits, see alignment E=1.9e-30 PF13692: Glyco_trans_1_4" amino acids 196 to 339 (144 residues), 71.7 bits, see alignment E=2e-23 PF13524: Glyco_trans_1_2" amino acids 290 to 359 (70 residues), 31.7 bits, see alignment E=3.7e-11

Best Hits

KEGG orthology group: None (inferred from 83% identity to kpu:KP1_3693)

Predicted SEED Role

"Putative glycosyl transferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6J0 at UniProt or InterPro

Protein Sequence (377 amino acids)

>BWI76_RS18965 bifunctional galactosyltransferase (Klebsiella michiganensis M5al)
MKKLCYFINSDWYFDLHWIDRAIAARDAGYEIHIISHFVDGKVLNKFKTFGFKCHNVPLD
AQSFNALTFFRAFFASRRIIKEINPDLLHCITIKPCLIGGLLSRANNRPVIVSFVGLGRV
FSCDTGLLKLLRNITIMAYKYIASNKRSIFMFEHDKDRKKLAGFVGIDYQQTIVIDGAGI
NPDIYKYSLEQERDVPVVLFASRMLWSKGLGDLIEAKKILESRNIHFTLNVAGILVENDK
DAISLAVIQQWHKEGLINWLGHSSNVCDLIEESNIVALPSIYSEGVPRILLEASSVGRAC
IAYDVGGCDSLIINNDNGIIVKSNSPQELADKLEFLLANPKARVEMGIKGRQRVQDKFSS
GMIISKTLKTYHDVVQG