Protein Info for BWI76_RS18955 in Klebsiella michiganensis M5al

Annotation: bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 199 PF01502: PRA-CH" amino acids 29 to 101 (73 residues), 112.4 bits, see alignment E=6.9e-37 PF01503: PRA-PH" amino acids 111 to 198 (88 residues), 83.7 bits, see alignment E=9.5e-28 TIGR03188: phosphoribosyl-ATP diphosphatase" amino acids 111 to 194 (84 residues), 102.8 bits, see alignment E=4.5e-34

Best Hits

Swiss-Prot: 90% identical to HIS2_KLEPN: Histidine biosynthesis bifunctional protein HisIE (hisI) from Klebsiella pneumoniae

KEGG orthology group: None (inferred from 92% identity to eae:EAE_23405)

MetaCyc: 89% identical to putative bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP pyrophosphatase (Escherichia coli K-12 substr. MG1655)
Phosphoribosyl-ATP diphosphatase. [EC: 3.6.1.31]; Phosphoribosyl-AMP cyclohydrolase. [EC: 3.6.1.31, 3.5.4.19]

Predicted SEED Role

"Phosphoribosyl-AMP cyclohydrolase (EC 3.5.4.19) / Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)" in subsystem Histidine Biosynthesis (EC 3.5.4.19, EC 3.6.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.4.19 or 3.6.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6Q8 at UniProt or InterPro

Protein Sequence (199 amino acids)

>BWI76_RS18955 bifunctional phosphoribosyl-AMP cyclohydrolase/phosphoribosyl-ATP diphosphatase (Klebsiella michiganensis M5al)
MLSEQLDWQKTDGLMPVIVQHAVSGEVLMLGYMNQDALAKTEETGKVTFYSRTKQRLWTK
GETSGNFLNVVSITPDCDNDTLLALVNPIGPTCHKGTSSCFGETGHQWLFLYQLEQLLAE
RKHADPESSYTAKLYASGTKRIAQKVGEEGVETALAATVHDQFELKNEASDLMYHLLVLL
QDQGLNLTDVVENLRSRHK