Protein Info for BWI76_RS18855 in Klebsiella michiganensis M5al

Annotation: cysteine desulfurase NifS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 TIGR03402: cysteine desulfurase NifS" amino acids 4 to 382 (379 residues), 589.6 bits, see alignment E=1.1e-181 PF00266: Aminotran_5" amino acids 4 to 365 (362 residues), 304.5 bits, see alignment E=5.3e-95

Best Hits

Swiss-Prot: 98% identical to NIFS_KLEPN: Cysteine desulfurase (nifS) from Klebsiella pneumoniae

KEGG orthology group: K04487, cysteine desulfurase [EC: 2.8.1.7] (inferred from 86% identity to kpe:KPK_1705)

Predicted SEED Role

"Cysteine desulfurase (EC 2.8.1.7), NifS subfamily" in subsystem Alanine biosynthesis or Nitrogen fixation (EC 2.8.1.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7

Use Curated BLAST to search for 2.8.1.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A285B6P2 at UniProt or InterPro

Protein Sequence (400 amino acids)

>BWI76_RS18855 cysteine desulfurase NifS (Klebsiella michiganensis M5al)
MKQVYLDNNATTRLDPMVLEAMMPFLTDFYGNPSSIHDFGIPAQAALERAHQQAAALLGA
EYPSEIIFTSCATEATATAIASAIALLPERREIITSVVEHPATLAACEHLERQGYRIHRI
AVDSEGALDMAQFRAALSPRVALVSVMWANNETGVLFPIGEMAELAHEQGALFHCDAVQV
VGKIPIAVGQTRIDMLSCSAHKFHGPKGVGCLYLRRGTRFRPLLRGGHQEYGRRAGTENI
CGIVGMGAACELANIHLPGMTHIGQLRNRLEHRLLASVPSVMVMGGGQPRVPGTVNLAFE
FIEGEAILLLLNQAGIAASSGSACTSGSLEPSHVMRAMNIPYTAAHGTIRFSLSRYTREK
EIDYVVATLPPIIDRLRALSPYWQNGKPRPADAVFTPVYG